Comparing 350802 FitnessBrowser__Btheta:350802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6voqA Crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae
33% identity, 84% coverage: 26:203/212 of query aligns to 27:207/207 of 6voqA
Q58813 L-fuculose phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
28% identity, 82% coverage: 10:183/212 of query aligns to 6:172/181 of Q58813
P0DTQ0 5-deoxy-D-ribulose 1-phosphate aldolase; 5-deoxyribose disposal aldolase; EC 4.1.2.- from Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) (see paper)
27% identity, 95% coverage: 1:202/212 of query aligns to 1:203/213 of P0DTQ0
6btgA Crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis (see paper)
27% identity, 95% coverage: 1:202/212 of query aligns to 1:203/207 of 6btgA
4fuaA L-fuculose-1-phosphate aldolase complex with pgh (see paper)
27% identity, 82% coverage: 26:199/212 of query aligns to 26:199/206 of 4fuaA
P0AB87 L-fuculose phosphate aldolase; D-ribulose-phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Escherichia coli (strain K12) (see 4 papers)
27% identity, 82% coverage: 26:199/212 of query aligns to 26:199/215 of P0AB87
Sites not aligning to the query:
1dzuP L-fuculose-1-phosphate aldolase from escherichia coli mutant t26a (see paper)
27% identity, 82% coverage: 26:199/212 of query aligns to 26:199/209 of 1dzuP
2fuaA L-fuculose 1-phosphate aldolase crystal form t with cobalt (see paper)
27% identity, 82% coverage: 26:199/212 of query aligns to 26:199/210 of 2fuaA
Sites not aligning to the query:
7x78A L-fuculose 1-phosphate aldolase (see paper)
31% identity, 68% coverage: 26:169/212 of query aligns to 23:163/203 of 7x78A
Sites not aligning to the query:
4c25A L-fuculose 1-phosphate aldolase (see paper)
27% identity, 83% coverage: 26:200/212 of query aligns to 29:204/212 of 4c25A
2z7bA Crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4, 5-dicarboxylate decarboxylase (see paper)
27% identity, 64% coverage: 66:200/212 of query aligns to 67:210/237 of 2z7bA
Q988D0 3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase; HMPDdc; EC 4.1.1.51 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see paper)
27% identity, 64% coverage: 66:200/212 of query aligns to 64:207/234 of Q988D0
>350802 FitnessBrowser__Btheta:350802
MITDEHIELFLAQAHRYGDAKLMLCSSGNLSWRIGEEALISGTGSWVPTLAKEKVSICNI
ASGTPTNGVKPSMESTFHLGVLRERPDVNVVLHFQSEYATAISCMKNKPTNFNVTAEIPC
HVGSEIPVIPYYRPGSPELAKAVVEAMLKHNSVLLTNHGQVVCGKDFDQVYERATFFEMA
CRIIVQSGGDYSVLTPEEIEDLEIYVLGKKTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory