Comparing 350804 FitnessBrowser__Btheta:350804 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
2qlxA Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose (see paper)
28% identity, 76% coverage: 29:127/130 of query aligns to 15:107/108 of 2qlxA
Sites not aligning to the query:
2qlwB Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum (see paper)
28% identity, 76% coverage: 29:127/130 of query aligns to 15:107/108 of 2qlwB
>350804 FitnessBrowser__Btheta:350804
METPQTGYQVKTYNVPVKRYCQTLDLRDSPELIAEYRKRHSQAEVWPEILAGIREVGILE
MEIYILGTRLFMIVETPVDFDWDTAMARLNTLPRQQEWEEYMSILQQAAPGMSSAEKWIP
MERMFHLYNT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory