Comparing 350816 FitnessBrowser__Btheta:350816 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
35% identity, 71% coverage: 32:350/449 of query aligns to 4:291/323 of 4eqbA
Sites not aligning to the query:
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
28% identity, 82% coverage: 30:399/449 of query aligns to 27:346/348 of P0AFK9
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
28% identity, 82% coverage: 30:399/449 of query aligns to 2:321/323 of 1poy1
7xjnA Structure of vcpotd1 in complex with norspermidine
29% identity, 69% coverage: 28:339/449 of query aligns to 1:281/322 of 7xjnA
Sites not aligning to the query:
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 76% coverage: 1:339/449 of query aligns to 1:322/365 of Q9I6J0
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
29% identity, 69% coverage: 32:339/449 of query aligns to 2:295/335 of 3ttnA
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/348 of 7oywA
Sites not aligning to the query:
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 89% coverage: 1:398/449 of query aligns to 2:364/367 of Q9I6J1
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/341 of 7oyvA
Sites not aligning to the query:
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/347 of 7oyxB
Sites not aligning to the query:
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
26% identity, 73% coverage: 12:338/449 of query aligns to 12:328/370 of P31133
Sites not aligning to the query:
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/341 of 6ye6A
Sites not aligning to the query:
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/341 of 6ye0B
Sites not aligning to the query:
1a99A Putrescine receptor (potf) from e. Coli (see paper)
27% identity, 69% coverage: 29:338/449 of query aligns to 1:300/341 of 1a99A
3ttmA Crystal structure of spud in complex with putrescine (see paper)
25% identity, 82% coverage: 30:398/449 of query aligns to 3:339/341 of 3ttmA
>350816 FitnessBrowser__Btheta:350816
MKRIVAVNLFLLVLAGFLSGCYNSGEPRERVLKIYNWADYIGEGVLEDFQAYYKEQTGED
IRIVYQTFDINEIMLTKIEKGHEDFDVVCPSEYIIERMLKKHLLLPIDTTFAHSPNYMNN
VSPFIREQINKLSQPGEEASRYAVCYMWGTAGILYNRAYVPDSDAFSWECLWDKKYAGKI
LMKDSYRDAYGTAVIYAHAKELEEGTVTVEDLMNDYSPRAMEVAEKYLKAMKPNIAGWEA
DFGKEMMTKNKAWLNMTWSGDAIWAIEEANAVGVDLDYVVPKEGSNIWYDGWVIPKYAKN
PVAASYFINFMCRPDIALRNMDFCGYVSSIATPEILEEKVDTTLDYYADLSYFFDPDADS
IQIDKIQYPDRKVVERCAMIRDFGDKTKEVLDIWSRIKGDNLGVGITILIFVVVALMSGW
MIYKRWQRYSRRKQQNRRSRRKRKKNVKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory