SitesBLAST
Comparing 350849 FitnessBrowser__Btheta:350849 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
60% identity, 98% coverage: 5:252/252 of query aligns to 10:257/257 of P0AAH0
- G48 (= G43) mutation to I: Loss of phosphate transport.
- K49 (= K44) mutation to Q: Loss of phosphate transport.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3c4jA Abc protein artp in complex with atp-gamma-s
40% identity, 98% coverage: 6:251/252 of query aligns to 4:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
40% identity, 98% coverage: 6:251/252 of query aligns to 4:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
40% identity, 98% coverage: 6:251/252 of query aligns to 4:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
40% identity, 98% coverage: 6:251/252 of query aligns to 4:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 96% coverage: 6:247/252 of query aligns to 3:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 96% coverage: 6:248/252 of query aligns to 2:237/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y15), V16 (≠ A20), S36 (= S40), G37 (= G41), S38 (≠ C42), G39 (= G43), K40 (= K44), S41 (= S45), T42 (= T46), E162 (= E174), H194 (= H205)
- binding magnesium ion: S41 (= S45), E162 (= E174)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 91% coverage: 18:247/252 of query aligns to 18:241/343 of P30750
- 40:46 (vs. 40:46, 86% identical) binding ATP
- E166 (= E174) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding L-methionine
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding L-methionine
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 91% coverage: 18:247/252 of query aligns to 19:242/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: I19 (≠ F18), S41 (= S40), G42 (= G41), A43 (≠ C42), G44 (= G43), K45 (= K44), S46 (= S45), T47 (= T46), N141 (vs. gap), S143 (= S150), Q146 (= Q153), H200 (= H205)
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 91% coverage: 18:247/252 of query aligns to 19:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 91% coverage: 18:247/252 of query aligns to 19:242/344 of 3tuiC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 88% coverage: 25:247/252 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
37% identity, 88% coverage: 25:247/252 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
38% identity, 85% coverage: 25:238/252 of query aligns to 46:254/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S40), G62 (= G41), G64 (= G43), K65 (= K44), S66 (= S45), T67 (= T46), Q111 (= Q93), K161 (≠ E144), Q162 (≠ S145), S164 (= S150), G166 (= G152), M167 (≠ Q153), Q188 (≠ E174), H221 (= H205)
Sites not aligning to the query:
P21439 Phosphatidylcholine translocator ABCB4; ATP-binding cassette sub-family B member 4; Multidrug resistance protein 3; P-glycoprotein 3; EC 7.6.2.1 from Homo sapiens (Human) (see 22 papers)
35% identity, 90% coverage: 2:227/252 of query aligns to 388:610/1286 of P21439
- Y403 (= Y15) to H: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol; dbSNP:rs121918443
- R406 (vs. gap) binding ATP; to Q: found in patients with cholangitis; uncertain significance; dbSNP:rs763807769
- GCGKST 432:437 (= GCGKST 41:46) binding ATP
- K435 (= K44) mutation to M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
- E450 (= E64) to G: in dbSNP:rs1189003716
- D459 (≠ N73) to H: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression
- Q477 (= Q93) binding ATP
- P479 (= P95) to L: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs748657435
- L481 (≠ P97) to R: in PFIC3; does not alter cytoplasmic and cell membrane location; inhibits efflux activity for PC and cholesterol
- A511 (vs. gap) to T: in PFIC3 and GBD1; dbSNP:rs1257887155
- E528 (= E144) to D: in GBD1; uncertain significance; moderate decrease of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs8187797
- G535 (= G151) to D: in PFIC3; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs1810849139
- G536 (= G152) binding ATP; to R: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location
- I541 (≠ L157) to F: in PFIC3 and GBD1; dbSNP:rs66904256
- A546 (= A162) to D: in ICP3; disruption of protein trafficking with subsequent lack of functional protein at the cell surface; dbSNP:rs121918441
- E558 (= E174) mutation to Q: Loss of floppase activity. Strongly reduce the ATPase activity.
- H589 (= H205) to T: in GBD1; requires 2 nucleotide substitutions
- R590 (≠ N206) to Q: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs45575636
Sites not aligning to the query:
- 34 modified: Phosphothreonine; T → M: in GBD1; reduces efflux activity for PC in a phosphorylation-dependent manner; dbSNP:rs142794414; T→D: Does not inhibit efflux activity for PC.
- 44 T→A: Reduces efflux activity for PC. Does not alter apical membrane location.
- 47 R → G: in GBD1; partly retained intracellularly; reduces efflux activity for PC in a phosphorylation-dependent manner; R → Q: found in patients with cholangitis; uncertain significance; dbSNP:rs372685632
- 49 S→A: Reduces efflux activity for PC. Does not alter apical membrane location.
- 68 G → R: in PFIC3; retained in the reticulum endoplasmic; greatly reduced expression; dbSNP:rs1343667900
- 73 L → V: in PFIC3 and GBD1; dbSNP:rs8187788
- 87 natural variant: D -> E
- 95 P → S: in dbSNP:rs377268767
- 175 T → A: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs58238559
- 201 T → M: in PFIC3; greatly reduced expression; alters efflux activity for PC; dbSNP:rs753318087
- 238 L → V: in dbSNP:rs45596335
- 263 I → V: in dbSNP:rs45547936
- 286 A → V: in PFIC3 and GBD1; does not alter plasma membrane location; inhibits efflux activity for PC; dbSNP:rs765478923
- 320 S → F: in ICP3, GBD1 and PFIC3; uncertain significance; does not alter plasma membrane location; does not inhibit efflux activity for PC; dbSNP:rs72552778
- 367 I → V: in dbSNP:rs1168923653
- 651 T → N: in dbSNP:rs45476795
- 652 R → G: in dbSNP:rs2230028
- 726 P → L: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs141677867
- 742 natural variant: G -> S
- 764 I → L: in a heterozygous patient with risperidone-induced cholestasis
- 775 T → M: found in patients with cholangitis; uncertain significance; dbSNP:rs148052192
- 788 R → Q: in GBD1; benign; dbSNP:rs8187801
- 934 A → T: found in patients with gallbladder and cholestasis; uncertain significance; dbSNP:rs61730509
- 953 A→D: Accumulates predominantly in intracellular compartments with only a small fraction at the plasma membrane and inhibits partially the efflux activity for PC.
- 964 V → T: found in patients with cholangitis; uncertain significance; requires 2 nucleotide substitutions
- 978 S → P: in PFIC3; alters efflux activity for PC; dbSNP:rs1051861187
- 985 V→M: Significantly reduces phosphatidylcholine floppase activity; when associated with Q-989 and V-990.
- 989 H→Q: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and V-990.
- 990 A→V: Significantly reduces phosphatidylcholine floppase activity; when associated with M-985 and Q-989.
- 1046 binding ATP
- 1071:1077 binding ATP
- 1075 K→M: Inhibits efflux activity for PC and cholesterol, but does not alter glycosylation and surface expression in the presence of taurocholate.
- 1082 L → Q: in a heterozygous patient with amoxicillin/clavulanic acid-induced cholestasis; dbSNP:rs1214110864
- 1124 binding ATP
- 1125 E → K: in PFIC3; alters efflux activity for PC
- 1168 P → S: in GBD1; reduced phosphatidylcholine transporter activity; does not alter plasma membrane location; dbSNP:rs121918442
- 1183 S → L: in GBD1; severely reduced phosphatidylcholine transporter activity; does not alter plasma membrane location
- 1184:1186 binding ATP
- 1185 G → S: in GBD1; loss of phosphatidylcholine transporter activity; does not alter plasma membrane location
7niwA Nanodisc reconstituted human abcb4 in complex with 4b1-fab (posaconazole-bound, inward-open conformation) (see paper)
35% identity, 90% coverage: 2:227/252 of query aligns to 337:559/1140 of 7niwA
Sites not aligning to the query:
- binding cholesterol: 70, 152, 160, 266, 641, 645, 648, 839
- binding 1,2-dilinoleoyl-sn-glycero-3-phosphocholine: 173, 183, 250, 254, 257, 261, 286, 294, 298, 617, 882
- binding posaconazole: 250, 291, 294, 658, 661, 726, 841, 871, 874, 878, 882
6s7pA Nucleotide bound abcb4 (see paper)
35% identity, 90% coverage: 2:227/252 of query aligns to 327:549/1128 of 6s7pA
- binding adenosine-5'-triphosphate: Y342 (= Y15), S344 (vs. gap), R345 (vs. gap), G371 (= G41), G373 (= G43), K374 (= K44), S375 (= S45), Q416 (= Q93), Q471 (≠ A148), S473 (= S150), G475 (= G152), Q476 (= Q153)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 920, 922, 923, 948, 949, 951, 952, 953, 954, 994, 1033, 1053, 1054, 1056
- binding cholesterol: 25, 32, 35, 65, 824, 834, 834, 838
- binding magnesium ion: 953, 994
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 100% coverage: 1:251/252 of query aligns to 2:257/258 of P02915
- S41 (= S40) binding ATP
- G42 (= G41) binding ATP
- G44 (= G43) binding ATP
- K45 (= K44) binding ATP
- S46 (= S45) binding ATP
- T47 (= T46) binding ATP
6qexA Nanodisc reconstituted human abcb1 in complex with uic2 fab and taxol (see paper)
35% identity, 90% coverage: 2:227/252 of query aligns to 355:577/1182 of 6qexA
Sites not aligning to the query:
- binding cholesterol: 15, 18, 36, 43, 81, 86, 89, 189, 281, 745, 749, 751, 755, 757, 761, 762, 765, 769, 772, 775, 854, 857, 861, 864, 865
- binding taxol: 38, 276, 279, 305, 312, 313, 316, 631, 852, 859, 889, 892, 896
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
36% identity, 97% coverage: 5:249/252 of query aligns to 2:251/258 of 1b0uA
Query Sequence
>350849 FitnessBrowser__Btheta:350849
MDTVKIDTRDVNFWYGDFHALKGISMQIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPA
TRLEGEIRIDGHNIYAKGVEVDELRKNVGMVFQRPNPFPKSIFENVAYGLRVNGVKDNAF
IRQRVEETLKGAALWDEVKDKLKESAYALSGGQQQRLCIARAMAVSPSVLLMDEPASALD
PISTAKVEELIHELKKDYTIVIVTHNMQQAARVSDKTAFFYLGEMVEYDDTKKIFTNPEK
EATQNYITGRFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory