SitesBLAST
Comparing 350921 FitnessBrowser__Btheta:350921 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4bifA Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria (see paper)
43% identity, 29% coverage: 47:161/401 of query aligns to 14:129/131 of 4bifA
E8WYN5 (R)-mandelonitrile lyase; Hydroxynitrile lyase; GtHNL; EC 4.1.2.10 from Granulicella tundricola (strain ATCC BAA-1859 / DSM 23138 / MP5ACTX9) (see paper)
43% identity, 29% coverage: 47:161/401 of query aligns to 14:129/131 of E8WYN5
- F19 (= F52) mutation to V: Increases active towards (S)-2-chloromandelonitrile in vitro.
- T20 (= T53) mutation to A: Increases catalytic activity and enantioselectivity in vitro; when associated with L-3.
- I25 (≠ L58) mutation to M: Increases catalytic activity and enantioselectivity in vitro; when associated with Q-36.
- F29 (≠ T62) mutation to L: Increases enzymatic activity and enantioselectivity in vitro; when associated with R-36 and A-42.
- L36 (vs. gap) mutation to Q: Increases catalytic activity and enantioselectivity in vitro; when associated with M-25.; mutation to R: Increases enzymatic activity and enantioselectivity in vitro; when associated with L-29 and A-42.
- A40 (≠ S72) mutation to H: Increases enzymatic activity and enantioselectivity in vitro. Further increases in enzymatic activity and enantioselectivity in vitro; when associated with T-42 and H-110.; mutation to R: Increases enzymatic activity and enantioselectivity in vitro.
- V42 (= V74) mutation to A: Increases enzymatic activity and enantioselectivity in vitro; when associated with L-29 and R-36.; mutation to T: Increases enzymatic activity and enantioselectivity in vitro. Further increases in enzymatic activity and enantioselectivity in vitro; when associated with H-40 and H-110.
- T50 (≠ N82) mutation to A: Does not affect mandelonitrile synthesis in vitro.
- H53 (= H85) binding ; mutation to A: Loss of mandelonitrile cyanolysis and cyanohydrin synthesis activity in vitro. Reduced metal binding in vitro.
- H55 (= H87) binding ; mutation to A: Loss of mandelonitrile cyanolysis and cyanohydrin synthesis activity in vitro. Reduced metal binding in vitro.
- Q59 (= Q91) binding ; mutation to A: Loss of mandelonitrile cyanolysis and cyanohydrin synthesis activity in vitro. Decreased metal binding in vitro.
- H94 (= H126) binding ; mutation to A: Decreased mandelonitrile cyanolysis activity in vitro. Decreased metal binding in vitro.
- H96 (= H128) binding ; mutation to A: Decreased mandelonitrile cyanolysis activity but complete loss of mandelonitrile synthesis activity and enantioselectivity in vitro. Does not affect metal binding in vitro.; mutation H->K,D: Results in a soluble but inactive enzyme in vitro.; mutation to R: Results in an insoluble protein in vitro.
- H106 (= H138) mutation H->A,L: Results in soluble proteins but inactive in vitro.; mutation to D: Partial loss of mandelonitrile synthesis activity in vitro.
- I109 (= I141) mutation to L: Increases catalytic activity and enantioselectivity in vitro; when associated with V-117.
- Q110 (≠ G142) mutation to H: Increases enzymatic activity and enantioselectivity in vitro. Further increases in enzymatic activity and enantioselectivity in vitro; when associated with H-40 and T-42.
- A117 (≠ K149) mutation to V: Increases catalytic activity and enantioselectivity in vitro; when associated with L-109.
- W120 (= W152) mutation to R: Increases activity towards both enantiomers for 2-chloromandelonitrile in vitro.
Sites not aligning to the query:
- 3 I→L: Increases catalytic activity and enantioselectivity in vitro; when associated with A-20.
Query Sequence
>350921 FitnessBrowser__Btheta:350921
MRKLFFIFVTVIGFLQIPMQSINAQSMKKEEVPQNISAFPLGKENTGFKQYFTGESWLAP
LTGNKDLNVPMSNVTFEPGCRNNWHSHTGGQILIAVGGVGYYQERGKAARRLLPGDVVEI
APDIEHWHGAAPDSWFSHLAIGCNPQTNKNIWLEQVDDQQYAEATKDNGGTGLSATDPEL
DAIFGNFTKEVQQYGNLDTKTRLMVTLASNIASQAQTEYRMMLESALNAGITPIEIKEIL
YQAVAYAGMAKVMDFVGITNEALLAHGVRLPLEGQAVVSAETRFDKGLALQKSIFGERID
QMHKNAPENQKHIQRYLSANCFGDYQTRGGLDVKTRELLTFSILVSLGGCESQVKGHIQG
NVNVGNNKDTLLAVVTQLLPYIGYPRTLNAIACLNEVIPEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory