Comparing 350926 FitnessBrowser__Btheta:350926 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
45% identity, 100% coverage: 1:384/385 of query aligns to 1:387/388 of 4dq6A
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
44% identity, 99% coverage: 4:384/385 of query aligns to 2:386/387 of 6qp3A
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
35% identity, 100% coverage: 1:385/385 of query aligns to 1:391/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
35% identity, 100% coverage: 1:385/385 of query aligns to 1:391/394 of 1c7nA
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
36% identity, 99% coverage: 3:384/385 of query aligns to 2:394/397 of 7qugA
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
36% identity, 100% coverage: 1:384/385 of query aligns to 6:397/398 of 6qp1B
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
36% identity, 99% coverage: 3:384/385 of query aligns to 1:378/383 of 6qp2A
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
35% identity, 98% coverage: 2:380/385 of query aligns to 2:381/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
35% identity, 98% coverage: 2:380/385 of query aligns to 2:381/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
35% identity, 98% coverage: 2:380/385 of query aligns to 2:381/387 of 3b1cA
5z0qC Crystal structure of ovob (see paper)
35% identity, 99% coverage: 3:384/385 of query aligns to 1:375/379 of 5z0qC
3l8aB Crystal structure of metc from streptococcus mutans
34% identity, 98% coverage: 2:380/385 of query aligns to 1:379/385 of 3l8aB
8bobA Structural basis for negative regulation of the maltose system (see paper)
33% identity, 99% coverage: 3:385/385 of query aligns to 2:387/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 99% coverage: 3:385/385 of query aligns to 2:387/390 of P23256
1j32A Aspartate aminotransferase from phormidium lapideum
23% identity, 93% coverage: 26:384/385 of query aligns to 31:384/388 of 1j32A
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
24% identity, 95% coverage: 21:385/385 of query aligns to 21:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
24% identity, 95% coverage: 21:385/385 of query aligns to 21:383/388 of 1gd9A
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
24% identity, 93% coverage: 27:385/385 of query aligns to 31:397/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
24% identity, 93% coverage: 27:385/385 of query aligns to 31:397/399 of 5wmhA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
25% identity, 92% coverage: 26:380/385 of query aligns to 38:378/384 of 1o4sB
>350926 FitnessBrowser__Btheta:350926
MKYNFDEIVPRRGTNSYKWDSAGDADVLPMWVADMDFRTAPSVVEALKRRVEHGIFGYVR
VPDAYYEAITRWFAGRHGWQIEKEWIIYTTGVVPALSAVIKALTTPGDKVIVQTPVYNCF
FSSIRNNGCEVVANPLIYMNGTYQIDFIDLERKAADPSVKVLLLCNPHNPAGRVWTKQEL
TRLGEICLRNNIWVVADEIHCELVFPGHTYIPFASVSEEFLMHSVTCTSPSKAFNLAGLQ
IANIVSADTDIRMQIDKAININEVCDVNPFGVEALIAAYNDGEEWLEELNQYLFANYHYL
RAYFDEYLPEFPVLPLEGTYLVWVDCSALKQSSEDIVKTLLEKEKLWVNEGNLYGEAGER
FIRINIACPRQRLIEGLNRLRRALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory