SitesBLAST
Comparing 350961 FitnessBrowser__Btheta:350961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wuvA Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound NAD
39% identity, 98% coverage: 6:269/270 of query aligns to 7:278/280 of 4wuvA
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), G20 (= G19), V21 (≠ I20), L22 (= L21), D41 (= D40), L42 (≠ R41), T66 (= T65), N67 (≠ D66), V68 (= V67), G94 (≠ A93), G96 (= G95), L134 (= L123), I161 (≠ F150), Y176 (= Y165), K180 (= K169)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 97% coverage: 3:265/270 of query aligns to 1:242/244 of 4nbuB
- active site: G18 (≠ I20), N111 (= N124), S139 (= S152), Q149 (≠ V162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (= D106), K98 (≠ D111), S139 (= S152), N146 (≠ L159), V147 (≠ T160), Q149 (≠ V162), Y152 (= Y165), F184 (= F200), M189 (≠ L209), K200 (≠ R220)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ G19), G18 (≠ I20), I19 (≠ L21), D38 (= D40), F39 (≠ R41), V59 (≠ T65), D60 (= D66), V61 (= V67), N87 (≠ A93), A88 (= A94), G89 (= G95), I90 (= I103), T137 (≠ F150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P198), F184 (= F200), T185 (≠ F201), T187 (= T203), M189 (≠ L209)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 96% coverage: 10:268/270 of query aligns to 7:247/247 of P73574
- A14 (≠ G17) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ T160) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F200) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ L210) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 98% coverage: 4:267/270 of query aligns to 1:251/252 of 1vl8B
- active site: G17 (≠ I20), S143 (= S152), I154 (≠ V162), Y157 (= Y165), K161 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ G19), G17 (≠ I20), L18 (= L21), S37 (≠ D40), R38 (= R41), C63 (≠ T65), D64 (= D66), V65 (= V67), A91 (= A93), A92 (= A94), G93 (= G95), I94 (≠ G96), V114 (≠ L123), I141 (≠ F150), S143 (= S152), Y157 (= Y165), K161 (= K169), P187 (= P198), G188 (= G199), Y190 (≠ F201), T192 (= T203), M194 (≠ Q205), T195 (≠ N206)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 98% coverage: 4:267/270 of query aligns to 2:254/255 of 5itvA
- active site: G18 (≠ I20), S141 (= S152), Y154 (= Y165), K158 (= K169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (≠ G19), G18 (≠ I20), I19 (≠ L21), D38 (= D40), I39 (≠ R41), T61 (= T65), I63 (≠ V67), N89 (≠ A93), G91 (= G95), T139 (≠ F150), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P198), G185 (= G199), I186 (≠ F200), I187 (≠ F201)
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
35% identity, 97% coverage: 3:265/270 of query aligns to 1:254/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), M17 (≠ G19), G18 (≠ I20), M19 (≠ L21), D38 (= D40), R39 (= R41), D63 (= D66), I64 (≠ V67), A90 (= A93), A91 (= A94), S142 (= S152), Y156 (= Y165), K160 (= K169), P186 (= P198), G187 (= G199), M189 (≠ F201), T191 (= T203), P192 (≠ D204), M193 (≠ Q205)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
33% identity, 95% coverage: 10:265/270 of query aligns to 7:249/262 of G9FRD7
- SSTRGI 13:18 (≠ GGAGIL 16:21) binding
- R38 (= R41) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DV 66:67) binding
- N90 (= N97) binding
- T145 (≠ S152) binding
- Y158 (= Y165) binding ; binding
- K162 (= K169) binding
- IGT---RA 191:195 (≠ FLTDQNRA 201:208) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
33% identity, 95% coverage: 10:265/270 of query aligns to 6:248/261 of 5epoA
- active site: G16 (≠ I20), T144 (≠ S152), I152 (≠ T160), Y157 (= Y165), K161 (= K169), R193 (= R207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G16), T14 (≠ A18), R15 (≠ G19), G16 (≠ I20), I17 (≠ L21), R37 (= R41), F61 (≠ T65), N62 (≠ D66), N89 (= N97), Y90 (≠ M98), G91 (≠ A99), Y157 (= Y165), K161 (= K169), P187 (= P198), G188 (= G199), I190 (≠ F201), T192 (= T203), R193 (= R207), A194 (= A208), A195 (≠ L209)
- binding taurochenodeoxycholic acid: T93 (≠ A101), T144 (≠ S152), G146 (≠ S154), R154 (≠ V162), Y157 (= Y165), G188 (= G199), N198 (= N212), M199 (≠ P213), F203 (≠ L217)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 98% coverage: 5:269/270 of query aligns to 1:247/248 of Q9KJF1
- M1 (≠ F5) modified: Initiator methionine, Removed
- S15 (≠ G19) binding
- D36 (= D40) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (≠ A93) binding
- Y153 (= Y165) binding
- K157 (= K169) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 97% coverage: 7:269/270 of query aligns to 2:246/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ L21), D35 (= D40), I36 (≠ R41), I62 (≠ V67), N88 (≠ A93), G90 (= G95), I138 (≠ F150), S140 (= S152), Y152 (= Y165), K156 (= K169), I185 (≠ F201)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
34% identity, 94% coverage: 11:265/270 of query aligns to 3:242/244 of 1edoA
- active site: G12 (≠ I20), S138 (= S152), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ A18), R11 (≠ G19), I13 (≠ L21), N31 (vs. gap), Y32 (≠ L39), A33 (≠ D40), R34 (= R41), S35 (= S42), D59 (= D66), V60 (= V67), N86 (≠ A93), A87 (= A94), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P198), G182 (= G199), I184 (≠ F201), S186 (≠ T203), M188 (≠ Q205)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 97% coverage: 5:265/270 of query aligns to 1:245/247 of 4jroC
- active site: G16 (≠ I20), S142 (= S152), Q152 (≠ V162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ G19), G16 (≠ I20), I17 (≠ L21), N35 (vs. gap), Y36 (≠ L39), N37 (≠ D40), G38 (≠ R41), S39 (= S42), N63 (≠ D66), V64 (= V67), N90 (≠ A93), A91 (= A94), I93 (= I103), I113 (≠ L123), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P198), I188 (≠ F201), T190 (= T203)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 96% coverage: 9:267/270 of query aligns to 5:247/248 of 6ixmC
- active site: G16 (≠ I20), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (≠ G19), G16 (≠ I20), I17 (≠ L21), D36 (= D40), I37 (≠ R41), A61 (≠ T65), D62 (= D66), T63 (≠ V67), N89 (≠ A93), A90 (= A94), M140 (≠ F150), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P198), A186 (≠ G199), Y187 (≠ F200), I188 (≠ F201), L192 (= L209)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
32% identity, 95% coverage: 9:265/270 of query aligns to 8:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G16), R18 (≠ G19), G19 (≠ I20), I20 (≠ L21), D39 (= D40), R40 (= R41), C63 (≠ T65), I65 (≠ V67), N91 (≠ A93), G93 (= G95), I94 (= I103), V114 (≠ L123), Y155 (= Y165), K159 (= K169), I188 (≠ F201), T190 (= T203), T193 (≠ N206)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
31% identity, 96% coverage: 5:264/270 of query aligns to 1:245/250 of 7wbcA
- binding calcium ion: Y115 (≠ L130), P116 (= P131), H119 (≠ V134)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G16 (≠ I20), I17 (≠ L21), D36 (= D40), V37 (≠ R41), A61 (≠ T65), D62 (= D66), I63 (≠ V67), N89 (≠ A93), F138 (= F150), S140 (= S152), Y153 (= Y165), K157 (= K169), P183 (= P198), F184 (= F200), A185 (≠ F201), T187 (= T203), G189 (≠ Q205), V190 (≠ N206)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
31% identity, 97% coverage: 2:264/270 of query aligns to 9:260/262 of Q9L9F8
- S152 (= S152) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y165) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K169) mutation to I: Does not alter the catalytic turnover.
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
32% identity, 95% coverage: 9:265/270 of query aligns to 5:251/256 of 7do7A
- active site: G16 (≠ I20), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), R15 (≠ G19), G16 (≠ I20), I17 (≠ L21), S37 (≠ R41), D66 (= D66), A67 (≠ V67), N93 (≠ A93), A94 (= A94), G95 (= G95), I96 (= I103), V144 (≠ F150), S145 (≠ C151), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P198), G190 (= G199), I192 (≠ F201), T194 (= T203), I196 (≠ Q205)
- binding beta-L-rhamnopyranose: F99 (≠ D106), S146 (= S152), S148 (= S154), Q156 (≠ V162), Y159 (= Y165), N197 (= N206), D235 (= D249), M236 (≠ A250), R238 (≠ N252)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
32% identity, 95% coverage: 9:265/270 of query aligns to 5:251/256 of 7b81A
- active site: G16 (≠ I20), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S14 (≠ A18), R15 (≠ G19), I17 (≠ L21), D66 (= D66), A67 (≠ V67), N93 (≠ A93), A94 (= A94), G95 (= G95), I96 (= I103), T116 (≠ L123), V144 (≠ F150), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P198), G190 (= G199), I192 (≠ F201), T194 (= T203), I196 (≠ Q205)
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
32% identity, 96% coverage: 5:264/270 of query aligns to 3:245/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), I19 (≠ L21), D38 (= D40), L39 (≠ R41), C63 (≠ T65), N64 (≠ D66), V65 (= V67), N91 (≠ A93), A92 (= A94), G93 (= G95), I140 (≠ F150), S141 (≠ C151), Y155 (= Y165), K159 (= K169), P185 (= P198), G186 (= G199)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
31% identity, 95% coverage: 10:265/270 of query aligns to 5:244/246 of 3osuA
Query Sequence
>350961 FitnessBrowser__Btheta:350961
MNELFNVKDKVVVITGGAGILGKGIAAYLAKEGAKVVVLDRSEEAGKALVESIKAEGNEA
MFLYTDVMDKEVLEGNKVEIMKAYGRIDVLLNAAGGNMAGATIAPDKTFFDLQIDAFKKV
VDLNLFGTVLPTMVFAEIMVEQKKGSIVNFCSESALRPLTRVVGYGAAKAAIANFTKYMA
GELALKFGNGLRVNAIAPGFFLTDQNRALLTNPDGSLTDRSKTILAHTPFNRFGEPEDLY
GTIHYLISDASNFVTGTVAVIDGGFDAFSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory