SitesBLAST
Comparing 350970 FitnessBrowser__Btheta:350970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
59% identity, 52% coverage: 384:803/804 of query aligns to 5:423/429 of 6ed7A
- active site: Y17 (= Y396), Y144 (= Y524), D245 (= D625), K274 (= K654)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (= Y396), W52 (= W431), W52 (= W431), Y144 (= Y524), D147 (= D527), A217 (= A597), K274 (= K654), R391 (= R771), F393 (= F773), F393 (= F773)
- binding pyridoxal-5'-phosphate: G112 (= G491), S113 (= S492), Y144 (= Y524), H145 (= H525), D245 (= D625), I247 (= I627), K274 (= K654)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
59% identity, 52% coverage: 384:803/804 of query aligns to 5:423/429 of P12995
- Y17 (= Y396) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W431) binding
- GS 112:113 (= GS 491:492) binding
- Y144 (= Y524) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D527) mutation to N: Loss of aminotransferase activity.
- D245 (= D625) binding
- R253 (= R633) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K654) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G687) binding
- PT 308:309 (= PT 688:689) binding
- R391 (= R771) binding ; mutation to A: Reduces aminotransferase activity.
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
59% identity, 52% coverage: 384:803/804 of query aligns to 5:423/429 of 1dtyA
- active site: Y17 (= Y396), Y144 (= Y524), E211 (= E591), D245 (= D625), A248 (= A628), K274 (= K654), Y398 (= Y778)
- binding pyridoxal-5'-phosphate: G112 (= G491), S113 (= S492), Y144 (= Y524), H145 (= H525), D245 (= D625), I247 (= I627), K274 (= K654)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
59% identity, 52% coverage: 384:803/804 of query aligns to 5:422/427 of 1mlzA
- active site: Y17 (= Y396), Y144 (= Y524), E210 (= E591), D244 (= D625), A247 (= A628), K273 (= K654), Y397 (= Y778)
- binding pyridoxal-5'-phosphate: G112 (= G491), S113 (= S492), Y144 (= Y524), H145 (= H525), D244 (= D625), I246 (= I627), K273 (= K654), P307 (= P688), T308 (= T689)
- binding trans-amiclenomycin: W52 (= W431), W53 (= W432), Y144 (= Y524), K273 (= K654), R390 (= R771), F392 (= F773)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
59% identity, 52% coverage: 384:803/804 of query aligns to 5:422/427 of 1mlyA
- active site: Y17 (= Y396), Y144 (= Y524), E210 (= E591), D244 (= D625), A247 (= A628), K273 (= K654), Y397 (= Y778)
- binding cis-amiclenomycin: W52 (= W431), W53 (= W432), K273 (= K654), R390 (= R771), F392 (= F773)
- binding pyridoxal-5'-phosphate: G112 (= G491), S113 (= S492), Y144 (= Y524), H145 (= H525), D244 (= D625), I246 (= I627), K273 (= K654), P307 (= P688), T308 (= T689)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
58% identity, 52% coverage: 384:803/804 of query aligns to 5:411/416 of 1qj3A
- active site: Y17 (= Y396), Y144 (= Y524), E201 (= E591), D235 (= D625), A238 (= A628), K264 (= K654), Y386 (= Y778)
- binding 7-keto-8-aminopelargonic acid: Y17 (= Y396), W52 (= W431), Y144 (= Y524), K264 (= K654), R379 (= R771), F381 (= F773)
- binding pyridoxal-5'-phosphate: G112 (= G491), S113 (= S492), Y144 (= Y524), H145 (= H525), G146 (= G526), D235 (= D625), I237 (= I627), A238 (= A628), K264 (= K654)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
56% identity, 52% coverage: 385:801/804 of query aligns to 7:413/420 of 6erkA
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:423/427 of 4cxqA
- active site: Y18 (= Y396), Y149 (= Y524), E212 (= E591), D246 (= D625), A249 (= A628), K275 (= K654), Y399 (= Y778)
- binding 7-keto-8-aminopelargonic acid: W56 (= W431), Y149 (= Y524), G308 (= G687), T310 (= T689), R392 (= R771)
- binding pyridoxal-5'-phosphate: G116 (= G491), S117 (= S492), Y149 (= Y524), H150 (= H525), G151 (= G526), E212 (= E591), D246 (= D625), I248 (= I627), K275 (= K654), P309 (= P688), T310 (= T689)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:421/425 of 4w1vA
- active site: Y18 (= Y396), Y147 (= Y524), E210 (= E591), D244 (= D625), A247 (= A628), K273 (= K654), Y397 (= Y778)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P395), Y18 (= Y396), W54 (= W431), M81 (= M458), G83 (= G460), Y147 (= Y524), G306 (= G687), P307 (= P688), T308 (= T689), F392 (= F773)
- binding pyridoxal-5'-phosphate: G114 (= G491), S115 (= S492), Y147 (= Y524), H148 (= H525), E210 (= E591), D244 (= D625), I246 (= I627), K273 (= K654)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:421/425 of 4cxrA
- active site: Y18 (= Y396), Y147 (= Y524), E210 (= E591), D244 (= D625), A247 (= A628), K273 (= K654), Y397 (= Y778)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (= Y396), W54 (= W431), W55 (= W432), A216 (= A597)
- binding pyridoxal-5'-phosphate: G114 (= G491), S115 (= S492), Y147 (= Y524), H148 (= H525), E210 (= E591), D244 (= D625), I246 (= I627), K273 (= K654), P307 (= P688), T308 (= T689)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 17:431/437 of P9WQ81
- Y25 (= Y396) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W431) binding
- Y157 (= Y524) binding
- K283 (= K654) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G687) binding
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 5kgtA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (= M458), G86 (= G460), G309 (= G687), T311 (= T689)
- binding pyridoxal-5'-phosphate: S116 (= S490), G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 5kgsA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), D162 (= D536), G165 (≠ T539), G166 (= G540), P310 (= P688), T311 (= T689), F395 (= F773)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4xjpA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), G165 (≠ T539), G166 (= G540), A219 (= A597), G220 (= G598), G309 (= G687), F395 (= F773)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4xjmA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), M158 (= M532), G165 (≠ T539), G166 (= G540), M167 (= M541), W171 (≠ F545), M307 (= M685), G309 (= G687), T311 (= T689)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4xjlA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), C161 (= C535), G165 (≠ T539), G166 (= G540), A219 (= A597)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4wygA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (= Y396), W57 (= W431), W58 (= W432), Y150 (= Y524), A219 (= A597), F395 (= F773)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4wyeA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a dsf fragment hit (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4wyeA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding phenyl(piperidin-4-yl)methanone: Y18 (= Y396), W57 (= W431), W58 (= W432), A219 (= A597), F395 (= F773), Y400 (= Y778)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4w1xA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 1-(4-(4-(3-chlorobenzoyl) piperazin-1-yl)phenyl)ethanone (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4w1xA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 1-{4-[4-(3-chlorobenzoyl)piperazin-1-yl]phenyl}ethanone: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), G165 (≠ T539), G166 (= G540), A219 (= A597), G309 (= G687), T311 (= T689)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
4w1wA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 7-(diethylamino)-3- (thiophene-2-carbonyl)-2h-chromen-2-one (see paper)
50% identity, 52% coverage: 388:802/804 of query aligns to 10:424/429 of 4w1wA
- active site: Y18 (= Y396), Y150 (= Y524), E213 (= E591), D247 (= D625), A250 (= A628), K276 (= K654), Y400 (= Y778)
- binding 7-(diethylamino)-3-(thiophen-2-ylcarbonyl)-2H-chromen-2-one: P17 (= P395), Y18 (= Y396), W57 (= W431), M84 (= M458), G86 (= G460), Y150 (= Y524), G165 (≠ T539), G309 (= G687), P310 (= P688), R393 (= R771)
- binding pyridoxal-5'-phosphate: G117 (= G491), S118 (= S492), Y150 (= Y524), H151 (= H525), G152 (= G526), E213 (= E591), D247 (= D625), I249 (= I627), K276 (= K654), P310 (= P688), T311 (= T689)
Query Sequence
>350970 FitnessBrowser__Btheta:350970
MKKQRHIQTTRSLLSRFRYWGRKNYAAFASMGREFQIGHLHTNVVDVALRKQNAKVTIPY
HTFMTLQEIKDQVLAGFDISSAQATWLANMADSEALYAAAHEITITCASHEFDMCSIINA
KSGRCPENCKWCAQSSHYKTQAEIYDLLPAEECLRQAKYNESQDVNRFSLVTSGRKPSPK
QISQLCDAARLMRKHSSIQLCASLGLLNEEELRALHTAGITRYHCNLETAPSYFPTLCST
HTQEQKLATLDAARRVGMDICCGGIIGMGETMEQRIEFAFTLAELNVQSIPINLLSPIPG
TPLENEKALSEEEILRTIALFRFINPTAFLRFAGGRSQLTPEAMRKALFVGINSAIVGDL
LTTLGSKVSDDKKMILEEGYHFADSQFDREHLWHPYTSTTDPLPVYKVKRADGATITLED
GRTLIEGMSSWWCAVHGYNHPVLNQAAKDQLDKMSHVMFGGLTHDPAIELGKLLLPLVPP
SMQKIFYADSGSVAVEVALKMAVQYWYAAGKPDKNNFVTIRSGYHGDTWNAMSVCDPVTG
MHSLFGSSLPVRYFVPAPSSRFDGEWNPDEIIPLRETIEKHSKELAALILEPIVQGAGGM
WFYHPQYLREAEKLCKEHDILLIFDEIATGFGRTGKLFAWEHAGVEPDIMCIGKALTGGY
MTLSAVLASNQIADTISNHAPKAFMHGPTFMGNPLACAVACASVRLLLDSGWAENVKRIE
AQLKEELAPARKFPQVADVRILGAIGVIQTERSVSMAYMQRRFVEEGIWVRPFGKLVYLM
PPFIISPEQLSKLTSGVLKIVREM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory