Comparing 350994 FitnessBrowser__Btheta:350994 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
50% identity, 86% coverage: 19:222/238 of query aligns to 21:224/226 of 5xu1B
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
45% identity, 100% coverage: 1:238/238 of query aligns to 3:238/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
45% identity, 100% coverage: 1:238/238 of query aligns to 3:238/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
48% identity, 95% coverage: 11:237/238 of query aligns to 14:243/650 of 5ws4A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
46% identity, 93% coverage: 1:221/238 of query aligns to 1:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
46% identity, 93% coverage: 1:221/238 of query aligns to 1:226/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
48% identity, 85% coverage: 17:219/238 of query aligns to 20:222/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
49% identity, 84% coverage: 21:221/238 of query aligns to 19:219/223 of 2pclA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
44% identity, 93% coverage: 1:221/238 of query aligns to 5:226/233 of P75957
7mdyC Lolcde nucleotide-bound
44% identity, 93% coverage: 1:221/238 of query aligns to 2:223/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
44% identity, 93% coverage: 1:221/238 of query aligns to 4:225/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
44% identity, 92% coverage: 1:220/238 of query aligns to 2:222/222 of 7arlD
8g4cB Bceabs atpgs high res tm (see paper)
42% identity, 84% coverage: 21:221/238 of query aligns to 23:224/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
41% identity, 84% coverage: 21:221/238 of query aligns to 22:223/245 of 7tchB
Sites not aligning to the query:
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
39% identity, 92% coverage: 1:218/238 of query aligns to 1:215/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
39% identity, 92% coverage: 1:218/238 of query aligns to 1:215/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
39% identity, 92% coverage: 1:218/238 of query aligns to 1:215/218 of 8hd0A
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 82% coverage: 19:213/238 of query aligns to 21:215/330 of P9WQK5
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
42% identity, 86% coverage: 18:221/238 of query aligns to 17:220/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
42% identity, 86% coverage: 18:221/238 of query aligns to 17:220/230 of 6z4wA
Sites not aligning to the query:
>350994 FitnessBrowser__Btheta:350994
MIKTEKLSMLFTTEEVQTKALNEVTLHVEQGEFVAIMGPSGCGKSTLLNILGTLDSPTSG
SYFFEGKQVDKMNENQLTALRKNNLGFIFQSFNLIDELTVYENVELPLVYMGIKTAQRKE
KVNKVLEKVNLLHRANHYPQQLSGGQQQRVAIARAVVTDCKLLLADEPTGNLDSVNGVEV
MELLSELNRQGTTIIIVTHSQRDATYAHRIIRLLDGQIVSENINRPLEKSTSSKNEAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory