SitesBLAST
Comparing 351020 FitnessBrowser__Btheta:351020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sbgA Crystal structure of b. Theta tryptophanase in holo form (see paper)
94% identity, 99% coverage: 1:456/459 of query aligns to 1:456/456 of 8sbgA
8sijA Crystal structure of f. Varium tryptophanase (see paper)
50% identity, 98% coverage: 7:454/459 of query aligns to 7:442/445 of 8sijA
2vlhA Quinonoid intermediate of citrobacter freundii tyrosine phenol-lyase formed with methionine (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 2vlhA
- active site: Y71 (= Y72), F123 (= F124), T124 (≠ D125), D214 (= D214), T216 (≠ A216), K257 (= K257), R381 (≠ I381), F448 (≠ H449)
- binding (2e)-2-{[(z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1h)-ylidene}methyl]imino}-4-(methylsulfanyl)butanoic acid: T49 (= T50), Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), N185 (= N185), D214 (= D214), R217 (= R217), S254 (= S254), K257 (= K257), R404 (= R404), F449 (= F450)
2vlfA Quinonoid intermediate of citrobacter freundii tyrosine phenol-lyase formed with alanine (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 2vlfA
- active site: Y71 (= Y72), F123 (= F124), T124 (≠ D125), D214 (= D214), T216 (≠ A216), K257 (= K257), R381 (≠ I381), F448 (≠ H449)
- binding (2e)-2-{[(z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1h)-ylidene}methyl]imino}propanoic acid: T49 (= T50), Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), N185 (= N185), D214 (= D214), T216 (≠ A216), R217 (= R217), S254 (= S254), K257 (= K257), R404 (= R404)
2ez2A Apo tyrosine phenol-lyase from citrobacter freundii at ph 8.0 (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 2ez2A
- active site: Y71 (= Y72), F123 (= F124), T124 (≠ D125), D214 (= D214), T216 (≠ A216), K257 (= K257), R381 (≠ I381), F448 (≠ H449)
- binding phosphate ion: Q98 (= Q99), G99 (= G100), R100 (= R101), S254 (= S254), K257 (= K257)
7tdlA M379a mutant tyrosine phenol-lyase complexed with 3-bromo-dl- phenylalanine (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 7tdlA
- binding (4Z)-4-({[(1E)-2-(3-bromophenyl)-1-carboxyethylidene]azaniumyl}methylidene)-2-methyl-5-[(phosphonooxy)methyl]-1,4-dihydropyridin-3-olate: F36 (= F37), T49 (= T50), Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), N185 (= N185), D214 (= D214), R217 (= R217), S254 (= S254), K257 (= K257), R404 (= R404), F448 (≠ H449)
7tcsA M379a mutant tyrosine phenol-lyase complexed with l-methionine (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 7tcsA
- binding (4Z)-4-({[(1E)-1-carboxy-3-(methylsulfanyl)propylidene]azaniumyl}methylidene)-2-methyl-5-[(phosphonooxy)methyl]-1,4-dihydropyridin-3-olate: F36 (= F37), T49 (= T50), Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), N185 (= N185), D214 (= D214), R217 (= R217), S254 (= S254), K257 (= K257), R404 (= R404), F449 (= F450)
6nv8B Perdeuterated tyrosine phenol-lyase from citrobacter freundii complexed with an aminoacrylate intermediate formed from s-ethyl-l- cysteine and 4-hydroxypyridine
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6nv8B
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), R380 (≠ I381), F447 (≠ H449)
- binding pyridin-4-ol: S39 (= S41), K40 (≠ E42)
- binding 2-amino-acrylic acid: F122 (= F124), K256 (= K257), R403 (= R404)
2yctA Tyrosine phenol-lyase from citrobacter freundii in complex with pyridine n-oxide and the quinonoid intermediate formed with l-alanine (see paper)
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 2yctA
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), R380 (≠ I381), F447 (≠ H449)
- binding pyridine-n-oxide: S11 (≠ M13), W60 (= W62), R99 (= R101), F122 (= F124), T123 (≠ D125), M378 (≠ C379), R380 (≠ I381), F447 (≠ H449), F448 (= F450)
- binding (2e)-2-{[(z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1h)-ylidene}methyl]imino}propanoic acid: T48 (= T50), S50 (= S52), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
- binding pyridoxal-5'-phosphate: Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), D213 (= D214), R216 (= R217), S253 (= S254), K256 (= K257)
- binding phosphate ion: T48 (= T50), F122 (= F124), N184 (= N185), R403 (= R404)
6mpdA Citrobacter freundii tyrosine phenol-lyase complexed with 4- hydroxypyridine and aminoacrylate from 3-f-l-tyrosine
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6mpdA
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), R380 (≠ I381), F447 (≠ H449)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: T48 (= T50), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
- binding pyridin-4-ol: R99 (= R101), F122 (= F124), T123 (≠ D125), Q227 (≠ R228), R322 (≠ E323), M378 (≠ C379), R380 (≠ I381), F447 (≠ H449), F448 (= F450)
- binding 3-fluorotyrosine: Y70 (= Y72), M287 (≠ Y288)
6mo3B Citrobacter freundii tyrosine phenol-lyase complexed with 4- hydroxypyridine and aminoacrylate from l-serine
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6mo3B
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), R380 (≠ I381), F447 (≠ H449)
- binding pyridin-4-ol: T14 (≠ P16), S39 (= S41), K40 (≠ E42)
- binding serine: T48 (= T50), S50 (= S52), F122 (= F124), K256 (= K257), R403 (= R404)
6mlsA Citrobacter freundii tyrosine phenol-lyase complexed with 4- hydroxypyridine and aminoacrylate from l-tyrosine
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6mlsA
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), R380 (≠ I381), F447 (≠ H449)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: T48 (= T50), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
- binding pyridin-4-ol: R99 (= R101), F122 (= F124), T123 (≠ D125), Q227 (≠ R228), R322 (≠ E323), M378 (≠ C379), R380 (≠ I381), F447 (≠ H449), F448 (= F450)
6durB Citrobacter freundii tyrosine phenol-lyase complexed with l- phenylalanine (see paper)
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6durB
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), F447 (≠ H449)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-phenylalanine: Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
2tplB Tyrosine phenol-lyase from citrobacter intermedius complex with 3-(4'- hydroxyphenyl)propionic acid, pyridoxal-5'-phosphate and cs+ ion (see paper)
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 2tplB
6dytB Citrobacter freundii tyrosine phenol-lyase f448a mutant complexed with l-alanine (see paper)
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6dytB
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), A447 (≠ H449)
- binding alanyl-pyridoxal-5'-phosphate: T48 (= T50), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), T215 (≠ A216), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
6dytA Citrobacter freundii tyrosine phenol-lyase f448a mutant complexed with l-alanine (see paper)
47% identity, 98% coverage: 6:455/459 of query aligns to 4:453/455 of 6dytA
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), A447 (≠ H449)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: T48 (= T50), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), T215 (≠ A216), R216 (= R217), S253 (= S254), K256 (= K257), R403 (= R404)
1c7gA Tyrosine phenol-lyase from erwinia herbicola
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 1c7gA
- active site: Y71 (= Y72), F123 (= F124), T124 (≠ D125), D214 (= D214), T216 (≠ A216), K257 (= K257), R381 (≠ I381), F448 (≠ H449)
- binding pyridoxal-5'-phosphate: Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), D214 (= D214), T216 (≠ A216), R217 (= R217), S254 (= S254), K257 (= K257)
2ycnA Y71f mutant of tyrosine phenol-lyase from citrobacter freundii in complex with quinonoid intermediate formed with 3-fluoro-l-tyrosine (see paper)
46% identity, 99% coverage: 1:455/459 of query aligns to 1:454/456 of 2ycnA
- active site: F71 (≠ Y72), F123 (= F124), T124 (≠ D125), D214 (= D214), T216 (≠ A216), K257 (= K257), R381 (≠ I381), F448 (≠ H449)
- binding (2E)-3-(3-fluoro-4-hydroxyphenyl)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}propanoic acid: T49 (= T50), Q98 (= Q99), G99 (= G100), R100 (= R101), F123 (= F124), T124 (≠ D125), T125 (= T126), N185 (= N185), D214 (= D214), R217 (= R217), S254 (= S254), K257 (= K257), M379 (≠ C379), R381 (≠ I381), R404 (= R404), F448 (≠ H449)
6durA Citrobacter freundii tyrosine phenol-lyase complexed with l- phenylalanine (see paper)
46% identity, 98% coverage: 6:455/459 of query aligns to 4:450/452 of 6durA
- active site: Y70 (= Y72), F122 (= F124), T123 (≠ D125), D213 (= D214), T215 (≠ A216), K256 (= K257), F444 (≠ H449)
- binding (2E)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-3-phenylpropanoic acid: T48 (= T50), Q97 (= Q99), G98 (= G100), R99 (= R101), F122 (= F124), N184 (= N185), D213 (= D214), T215 (≠ A216), R216 (= R217), S253 (= S254), K256 (= K257), R400 (= R404)
8v6pA Tryptophanase
47% identity, 98% coverage: 7:455/459 of query aligns to 6:463/465 of 8v6pA
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-(1H-pyrrolo[2,3-b]pyridin-3-yl)-L-alanine: T49 (= T50), S51 (= S52), Q98 (= Q99), G99 (= G100), R100 (= R101), F131 (= F124), D132 (= D125), T133 (= T126), N193 (= N185), D222 (= D214), R225 (= R217), S262 (= S254), K265 (= K257), L394 (= L385), R413 (= R404), H457 (= H449), F458 (= F450)
Query Sequence
>351020 FitnessBrowser__Btheta:351020
MELPFAESWKIKMVEPIRKSTREEREQWIKEAHYNVFQLKSEQVYIDLITDSGTGAMSDR
QWAGMMLGDESYAGATSFFKLKDTITRITGFEYIIPTHQGRAAENVLFSYLVHEGNIVPG
NSHFDTTKGHIEGRHAIALDCTIDEAKNTQLEIPFKGNVDPAKLEKALSEYADRIPFIIV
TITNNTAGGQPVSMQNLREVRAIANKYNKPVLFDSARFAENAYFIKMREKGYQDKSIKEI
TREMFDLADGMTMSAKKDGIVNMGGFIATRRKEWYEGAKGFCVQYEGYLTYGGMNGRDMN
ALAIGLDENTEFDNLETRIKQVEYLAQKLDEYEIPYQRPAGGHAIFVDASKVLTHVPKEE
FPAQTLTVELYLEAGIRGCEIGYILADRDPITHENRFNGLDLLRLAIPRRVYTDNHMNVI
AAALRNVFERRETITRGVRIAWEAPLMRHFTVQLERLSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory