Comparing 351076 FitnessBrowser__Btheta:351076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
45% identity, 93% coverage: 15:553/581 of query aligns to 8:551/581 of P18159
Q96G03 Phosphopentomutase; Glucose phosphomutase 2; Phosphodeoxyribomutase; Phosphoglucomutase-2; EC 5.4.2.7; EC 5.4.2.2 from Homo sapiens (Human) (see 2 papers)
35% identity, 94% coverage: 9:556/581 of query aligns to 14:577/612 of Q96G03
Sites not aligning to the query:
O74478 Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 94% coverage: 10:554/581 of query aligns to 5:556/587 of O74478
Q03262 Phosphoribomutase; PRM; Phosphoglucomutase 3; PGM 3; EC 5.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 94% coverage: 17:561/581 of query aligns to 20:597/622 of Q03262
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
27% identity, 86% coverage: 52:552/581 of query aligns to 5:434/455 of 1wqaA
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6nqhA
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6np8A
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6nolA
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6nnpA
Sites not aligning to the query:
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6nn2A
Sites not aligning to the query:
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6n1eA
Sites not aligning to the query:
6mnvA Crystal structure of x. Citri phosphoglucomutase in complex with ch2fg1p (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6mnvA
Sites not aligning to the query:
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 36:396/449 of 6mlwA
Sites not aligning to the query:
6mlhA Crystal structure of x. Citri phosphoglucomutase in complex with glucopyranosyl-1-methyl-phosphonic acid (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6mlhA
Sites not aligning to the query:
6mlfA Crystal structure of x. Citri phosphoglucomutase in complex with 6- fluoro glucose 1-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 6mlfA
Sites not aligning to the query:
5kl0A Crystal structure of phosphoglucomutase from xanthomonas citri citri complexed with glucose-1,6-biphosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 35:395/448 of 5kl0A
Sites not aligning to the query:
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
27% identity, 68% coverage: 91:487/581 of query aligns to 36:396/449 of 5bmpA
Sites not aligning to the query:
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
31% identity, 32% coverage: 130:315/581 of query aligns to 76:242/455 of 2h5aX
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
31% identity, 32% coverage: 130:315/581 of query aligns to 76:242/455 of 2h4lX
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
31% identity, 32% coverage: 130:315/581 of query aligns to 76:242/455 of 2fkfA
Sites not aligning to the query:
>351076 FitnessBrowser__Btheta:351076
MENQELIKQVTEKAEKWLTPAYDAETQAEVKRMLENEDKTELIEAFYKDLEFGTGGLRGI
MGVGSNRMNIYTVGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSAN
GIKVYLFDDMRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDAG
IIDEVNNIASAADIKFKGNPDLIQIIGEDIDKIYLDMVKTVSIDPEAIARHKDMKIVYTP
IHGTGMMLIPRALKMWGFENVFTVPEQMIKDGNFPTVISPNPENAEALSMAVNLAKEIDA
DLVMASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGNEFCVKTI
VTTELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKD
AVSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMEN
FRANPPKELGGSKVILSKDYKTLKQTDAEGKVTDLDMPETSNVLQYFTEDGSKVSVRPSG
TEPKIKFYMEVQGEMGCRNCFASADAAAMEKIEAVKKSLGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory