Comparing 351108 FitnessBrowser__Btheta:351108 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
30% identity, 95% coverage: 6:125/126 of query aligns to 3:123/139 of 2c21A
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
33% identity, 95% coverage: 6:125/126 of query aligns to 2:127/135 of P0AC81
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
24% identity, 94% coverage: 6:124/126 of query aligns to 2:126/128 of 4mttA
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
30% identity, 94% coverage: 6:124/126 of query aligns to 2:126/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
30% identity, 94% coverage: 6:124/126 of query aligns to 2:126/128 of 1fa5A
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 97% coverage: 3:124/126 of query aligns to 179:322/326 of P50107
Sites not aligning to the query:
>351108 FitnessBrowser__Btheta:351108
MEIKSRFDHFNINVTNLERSIAFYEKALGLKEHSRKEASDGSFILVYLTDNETGFLLELT
WLKDHTSPYELGENESHLCFRVAGDYDAIRQYHKEMNCVCFENTAMGLYFINDPDDYWIE
ILPQKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory