Comparing 351287 FitnessBrowser__Btheta:351287 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
37% identity, 80% coverage: 120:608/610 of query aligns to 1:532/537 of Q96TU3
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
38% identity, 76% coverage: 143:608/610 of query aligns to 5:513/517 of 1y9gA
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
37% identity, 76% coverage: 146:610/610 of query aligns to 13:512/512 of 6s2bA
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
37% identity, 76% coverage: 146:610/610 of query aligns to 13:512/512 of 6s1tA
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
33% identity, 74% coverage: 145:596/610 of query aligns to 28:501/516 of O94220
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
33% identity, 74% coverage: 145:596/610 of query aligns to 5:478/493 of 3rwkX
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
38% identity, 72% coverage: 140:581/610 of query aligns to 22:501/532 of P00724
Sites not aligning to the query:
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
45% identity, 48% coverage: 144:434/610 of query aligns to 33:330/534 of 8beqA
Sites not aligning to the query:
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
45% identity, 48% coverage: 144:434/610 of query aligns to 31:328/525 of 8betA
Sites not aligning to the query:
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
36% identity, 74% coverage: 144:595/610 of query aligns to 31:508/526 of 8besA
Sites not aligning to the query:
4ffgA Crystal structure of levan fructotransferase from arthrobacter ureafaciens in complex with dfa-iv (see paper)
33% identity, 76% coverage: 149:610/610 of query aligns to 3:479/480 of 4ffgA
4ffhA Crystal structure of levan fructotransferase d54n mutant from arthrobacter ureafaciens in complex with sucrose (see paper)
33% identity, 76% coverage: 149:610/610 of query aligns to 3:479/480 of 4ffhA
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
29% identity, 78% coverage: 135:609/610 of query aligns to 15:486/490 of 7vcpA
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
32% identity, 72% coverage: 144:581/610 of query aligns to 23:436/464 of 7bwcA
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
29% identity, 76% coverage: 144:609/610 of query aligns to 36:511/516 of 6nunA
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 74% coverage: 145:593/610 of query aligns to 2:417/432 of O33833
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
30% identity, 74% coverage: 145:593/610 of query aligns to 2:417/432 of 1w2tB
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
30% identity, 74% coverage: 145:593/610 of query aligns to 2:417/432 of 1w2tA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
28% identity, 76% coverage: 144:609/610 of query aligns to 38:513/526 of 3pijB
3uggA Crystal structure of a 6-sst/6-sft from pachysandra terminalis in complex with 1-kestose (see paper)
29% identity, 72% coverage: 146:584/610 of query aligns to 13:487/524 of 3uggA
>351287 FitnessBrowser__Btheta:351287
MNVFLPVKQLQTFLICFILMTISVSTRAADSPLLIKNLGEGHCLVRVNTSQNYLLLPVED
ASPDVRISMIVNNKEVKNFDVRLAIHKVDYFVPVDLSDFSGKTVSFKFKMNSNDPIRVNL
SPDNTACCKEMKLSDTFDTTNREKFRPTYHFSPLYGWMNDPNGMVYKDGEYHLFYQYNPY
GSKWGNMNWGHAISKDLVNWEHRPVAIAPDALGTIFSGSAVVDHNNTAGFGAGAIIAIYT
QNSDRQVQSIAYSTDNGRTFTKYENNPVLVSEARDFRDPKVFWYEATKRWIMVLAVGQEM
QIFSSPNLKDWAFESSFGEGYGAHGNVWECPDLFELPVEGTNEKKWVLLCSLGDGPFGDS
ATQYFIGSFDGKKFSCDNQPNVTKWMDWGKDHYATVTWSDAPDNRRIAIAWMSNWQYAND
VPTSQYRSPNSIPRDLSLFAIDGGIYLQSAPSPELLKLRGVSKKRSFKVNGTRIVKDLIP
NNEGAYEIELSLKNQQAEIIGFRLYNDKGEEVDMQYDMKEKKFSMDRRKSGEVNFNENFP
MLTWTAIEEDKDEMKLRLFVDRSSVEAFGDGGRFAMTNQVFPSEPYNHISFYSKGGAYKV
DSFVVYKLKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory