SitesBLAST
Comparing 351293 FitnessBrowser__Btheta:351293 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
34% identity, 77% coverage: 135:614/627 of query aligns to 26:521/537 of Q96TU3
- N67 (= N176) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ E215) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N300 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (≠ L474) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (≠ G505) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
34% identity, 77% coverage: 135:614/627 of query aligns to 7:502/517 of 1y9gA
- active site: D22 (= D150), E222 (= E323)
- binding beta-D-fructofuranose: N21 (= N149), D22 (= D150), Q38 (= Q166), W46 (= W174), F83 (= F206), S84 (= S207), R169 (= R271), D170 (= D272), E222 (= E323), Y294 (= Y389), W316 (= W410)
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
36% identity, 74% coverage: 136:601/627 of query aligns to 13:482/512 of 6s2bA
- active site: A27 (≠ D150), E207 (= E323)
- binding (2~{S},3~{R})-4-[(2~{R},3~{S},4~{S},5~{R})-2,5-bis(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]oxybutane-1,2,3-triol: N26 (= N149), Q45 (= Q166), W53 (= W174), F87 (= F206), S88 (= S207), R155 (= R271), D156 (= D272), E207 (= E323), Y270 (= Y389), W291 (= W410)
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
36% identity, 74% coverage: 136:601/627 of query aligns to 13:482/512 of 6s1tA
- active site: A27 (≠ D150), E207 (= E323)
- binding beta-D-fructofuranose: N26 (= N149), Q45 (= Q166), F87 (= F206), S88 (= S207), R155 (= R271), D156 (= D272), E207 (= E323), Y270 (= Y389)
- binding alpha-D-glucopyranose: W53 (= W174), E207 (= E323), W291 (= W410)
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
35% identity, 75% coverage: 130:600/627 of query aligns to 22:503/532 of P00724
- N23 (= N131) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- D42 (= D150) active site; mutation to N: Loss of activity.
- N64 (≠ Y170) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N97 (≠ D200) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ E215) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N118 (≠ A222) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (≠ S264) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N266 (≠ D366) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N275 (= N374) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N356 (≠ E449) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N369 (≠ S462) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N384 (≠ D477) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (≠ G491) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 1:19 signal peptide
- 512 modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
34% identity, 77% coverage: 132:612/627 of query aligns to 29:507/525 of 8betA
- binding beta-D-fructofuranose: N46 (= N149), Q64 (= Q166), Q75 (≠ M177), S106 (= S207), R170 (= R271), D171 (= D272), E221 (= E323)
- binding alpha-D-glucopyranose: F105 (= F206), E221 (= E323), N246 (= N348)
- binding alpha-D-mannopyranose: P92 (≠ A194), Y151 (≠ R250), S316 (vs. gap), A317 (vs. gap)
Sites not aligning to the query:
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
34% identity, 77% coverage: 132:612/627 of query aligns to 29:508/526 of 8besA
Sites not aligning to the query:
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
34% identity, 77% coverage: 132:612/627 of query aligns to 31:515/534 of 8beqA
Sites not aligning to the query:
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
28% identity, 79% coverage: 132:627/627 of query aligns to 2:492/493 of 3rwkX
- binding beta-D-fructofuranose: W17 (= W147), M18 (= M148), N19 (= N149), E20 (≠ D150), N38 (= N168), F76 (= F206), T77 (≠ S207), R152 (= R271), D153 (= D272), E210 (= E323), N297 (≠ M407), G300 (≠ C413)
- binding alpha-D-mannopyranose: G241 (= G355), N242 (≠ S356), R272 (≠ K386), R272 (≠ K386), S298 (= S408), D417 (≠ S536), P418 (= P537), P418 (= P537), A419 (≠ H538)
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
28% identity, 79% coverage: 132:627/627 of query aligns to 25:515/516 of O94220
- M41 (= M148) mutation to A: Decreases catalytic activity.
- N42 (= N149) mutation to G: Strongly decreases catalytic activity.
- E43 (≠ D150) mutation to D: Strongly decreases catalytic activity.
- Q59 (= Q166) mutation to A: Impairs catalytic activity.
- N61 (= N168) binding
- P62 (= P169) mutation to G: Impairs catalytic activity.
- W67 (= W174) mutation to A: Impairs catalytic activity.
- I70 (≠ M177) mutation to A: Decreases catalytic activity.
- F99 (= F206) mutation to A: Strongly decreases catalytic activity.
- R175 (= R271) mutation to A: Impairs catalytic activity.
- D176 (= D272) binding
- N265 (≠ S356) mutation to A: Decreases catalytic activity.
- R295 (≠ K386) mutation to A: Decreases catalytic activity.
- D298 (≠ Y389) mutation to A: Decreases catalytic activity.
- N320 (≠ M407) binding
- N372 (≠ S462) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 76% coverage: 135:610/627 of query aligns to 2:417/432 of O33833
- E190 (= E323) mutation to A: Loss of activity.; mutation to D: Reduced activity.
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
31% identity, 76% coverage: 135:610/627 of query aligns to 2:417/432 of 1w2tB
- active site: D17 (= D150), D190 (≠ E323)
- binding beta-D-fructofuranose: N16 (= N149), D17 (= D150), Q33 (= Q166), F74 (= F206), S75 (= S207), D138 (= D272), D190 (≠ E323), Y240 (= Y389)
- binding alpha-D-glucopyranose: R137 (= R271), T208 (≠ N348), W260 (= W410)
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
31% identity, 76% coverage: 135:610/627 of query aligns to 2:417/432 of 1w2tA
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
27% identity, 78% coverage: 134:625/627 of query aligns to 24:485/490 of 7vcpA
4ffgA Crystal structure of levan fructotransferase from arthrobacter ureafaciens in complex with dfa-iv (see paper)
28% identity, 78% coverage: 138:626/627 of query aligns to 2:478/480 of 4ffgA
- active site: D14 (= D150), E196 (= E323)
- binding (1R,4R,5S,6S,7R,10R,11S,12S)-1,7-bis(hydroxymethyl)-2,8,13,14-tetraoxatricyclo[8.2.1.1~4,7~]tetradecane-5,6,11,12-tetrol: N368 (≠ I495), Y393 (≠ V520), D395 (= D522), R411 (≠ I540), D463 (≠ K611)
- binding beta-D-fructofuranose: D128 (= D265), Y167 (≠ E293), N184 (≠ S310), D186 (vs. gap)
4ffhA Crystal structure of levan fructotransferase d54n mutant from arthrobacter ureafaciens in complex with sucrose (see paper)
28% identity, 78% coverage: 138:626/627 of query aligns to 2:478/480 of 4ffhA
- active site: N14 (≠ D150), E196 (= E323)
- binding beta-D-fructofuranose: N14 (≠ D150), W68 (≠ F206), S69 (= S207), R145 (= R271), D146 (= D272), E196 (= E323), Y258 (= Y389), N368 (≠ I495), N384 (≠ Y511), Y388 (≠ P515), Y393 (≠ V520), D395 (= D522), R411 (≠ I540)
- binding alpha-D-glucopyranose: R99 (≠ K235), R145 (= R271), E196 (= E323)
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
27% identity, 79% coverage: 133:625/627 of query aligns to 37:512/526 of 3pijB
- active site: D54 (= D150), E235 (= E323)
- binding beta-D-fructofuranose: N53 (= N149), D54 (= D150), Q70 (= Q166), M81 (= M177), F113 (= F206), S114 (= S207), R180 (= R271), D181 (= D272), E235 (= E323), Y302 (= Y389)
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
29% identity, 74% coverage: 134:598/627 of query aligns to 23:436/464 of 7bwcA
- binding beta-D-fructofuranose: N38 (= N149), Q55 (= Q166), M66 (= M177), F94 (= F206), S95 (= S207), R156 (= R271), D157 (= D272), E210 (= E323), W293 (= W410)
- binding alpha-D-glucopyranose: W63 (= W174), E210 (= E323), Q228 (≠ V345), W293 (= W410)
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
26% identity, 79% coverage: 133:625/627 of query aligns to 35:510/516 of 6nunA
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 74% coverage: 136:600/627 of query aligns to 121:616/664 of Q39041
Sites not aligning to the query:
- 2 mutation Missing: No effect on localization.
- 3 mutation Missing: Partial retention in the endoplasmic reticulum.
- 3:4 mutation Missing: Endoplasmic reticulum localization.
- 4 mutation Missing: Partial retention in the endoplasmic reticulum.
- 5 mutation Missing: Endoplasmic reticulum localization.
- 6 mutation Missing: No effect on localization.
- 7 mutation Missing: Partial retention in the endoplasmic reticulum.
- 7:8 Critical for endoplasmic reticulum export; LL→AA: Reduced vacuolar trafficking.; mutation Missing: Endoplasmic reticulum localization.
- 8 mutation Missing: Partial retention in the endoplasmic reticulum.
- 9 P→A: Partial retention in the endoplasmic reticulum.
- 9:10 Critical for endoplasmic reticulum export; PI→AA: Reduced vacuolar trafficking.
- 10 mutation Missing: Endoplasmic reticulum localization.
- 11 mutation Missing: Endoplasmic reticulum localization.
- 12 mutation Missing: No effect on localization.
- 14:16 Critical for trafficking from the trans-Golgi network to the prevacuolar compartment and from the prevacuolar compartment to the central vacuole; EEE→AAA: Reduced vacuolar trafficking.
- 18:21 LCPY→AAAA: Reduced vacuolar trafficking.
- 21:24 YTRL→AAAA: Reduced vacuolar trafficking.; mutation Missing: No effect on localization.
Query Sequence
>351293 FitnessBrowser__Btheta:351293
MKTTPWIKLCKGAVLALTVSFGLTYCQSTKSTFTLEQKGDSLTIVHITHPTNYILLPIEE
EEADESQVRLDTGNAADTDMDIRLAQTKVDYFVPFALPADTKVATLRIQKKSKDALCWEE
IKLSDTFDTTNTDKFRPVYHHTPLYGWMNDANGLVYKDGEYHLYYQYNPYGSKWGNMHWG
HSVSKDLMHWEHLAPAIARDTLGHIFSGSSIVDQENVAGYGAGSILAYYTSASDKNGQIQ
CLAYSKDNGRTFTKYEKNPVLRPSDGLKDFRDPKVFWYAPESKWVMIVSADKEMRFYDSH
NLKDWNYLSSFGEGYGVQPCQFECPDMVELPVDGDINYKKWALIVNVNPGCYFGGSATQY
FIGDFDGTKFICDNQPNVTKWLDWGKDHYATVCFSNTGDRVVAVPWMSNWQYCNIVPTRQ
FRSANALPRELGLYTQDNDIYLSAAPVAETKNLRKESKDVPSFTVDKDYHIESLLTDNEG
AYELSLNIEAGKAEIMGFSLFNDKGEKVDIYFNLPEKKLVMDRTKSGIVDFGKNSSPHEI
EAHDRRKTTSINYIDDFALATWAPIQKENEYKLDVFVDKCSVEIFLDGGKIAMTNLIFPT
EPYNRMCFYSKGGTFAVDSFSVYRLGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory