SitesBLAST
Comparing 351380 FitnessBrowser__Btheta:351380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
57% identity, 97% coverage: 5:310/317 of query aligns to 3:306/306 of 2q3dA
- active site: K44 (= K48), S266 (= S270), P293 (= P297)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K48), T71 (= T75), S72 (= S76), N74 (= N78), T75 (= T79), Q144 (= Q148), V177 (= V181), G178 (= G182), T179 (= T183), G180 (= G184), T182 (= T186), G222 (= G226), I223 (= I227), S266 (= S270), P293 (= P297), D294 (= D298)
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
57% identity, 97% coverage: 5:310/317 of query aligns to 3:306/310 of P9WP55
- K44 (= K48) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N78) binding
- GTGGT 178:182 (= GTGGT 182:186) binding
- S266 (= S270) binding
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
58% identity, 95% coverage: 10:309/317 of query aligns to 9:306/310 of 5xoqA
- binding : T72 (= T75), S73 (= S76), G74 (= G77), T76 (= T79), M123 (= M126), Q144 (= Q148), R218 (≠ S221), H219 (= H222), Q222 (= Q225), G223 (= G226), A226 (= A229)
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
56% identity, 97% coverage: 4:309/317 of query aligns to 2:308/318 of 4lmaA
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
55% identity, 96% coverage: 5:309/317 of query aligns to 3:308/310 of 4lmbA
- active site: K46 (= K48), S269 (= S270)
- binding cysteine: K46 (= K48), T74 (= T75), S75 (= S76), N77 (= N78), T78 (= T79), M101 (= M102), M125 (= M126), M125 (= M126), Q147 (= Q148), F148 (= F149), Q224 (= Q225), G225 (= G226), G225 (= G226), I226 (= I227), A228 (= A229)
- binding pyridoxal-5'-phosphate: K46 (= K48), N77 (= N78), V180 (= V181), G181 (= G182), T182 (= T183), G183 (= G184), T185 (= T186), G225 (= G226), S269 (= S270), P296 (= P297)
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
56% identity, 95% coverage: 5:304/317 of query aligns to 3:300/300 of 3zeiA
- active site: K44 (= K48), S266 (= S270), P293 (= P297)
- binding 3-[(Z)-[(5Z)-5-[[2-(2-hydroxy-2-oxoethyloxy)phenyl]methylidene]-3-methyl-4-oxidanylidene-1,3-thiazolidin-2-ylidene]amino]benzoic acid: T71 (= T75), S72 (= S76), I126 (= I130), Q144 (= Q148), F145 (= F149), K215 (≠ A219), G222 (= G226), A225 (= A229), F227 (= F231)
- binding pyridoxal-5'-phosphate: K44 (= K48), N74 (= N78), V177 (= V181), G178 (= G182), T179 (= T183), G180 (= G184), T182 (= T186), G222 (= G226), S266 (= S270), P293 (= P297), D294 (= D298)
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
56% identity, 95% coverage: 5:304/317 of query aligns to 3:300/300 of 2q3cA
- active site: K44 (= K48), S266 (= S270), P293 (= P297)
- binding : T71 (= T75), S72 (= S76), G73 (= G77), T75 (= T79), M122 (= M126), Q144 (= Q148), K215 (≠ A219), G222 (= G226), A225 (= A229)
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
55% identity, 97% coverage: 2:310/317 of query aligns to 1:313/323 of P0ABK5
- M1 (= M2) modified: Initiator methionine, Removed
- K42 (= K48) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Still stimulates tRNase activity of CdiA-CT in vitro and in vivo.
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
52% identity, 96% coverage: 5:309/317 of query aligns to 13:316/323 of 4aecA
- active site: K54 (= K48), S277 (= S270)
- binding pyridoxal-5'-phosphate: K54 (= K48), N85 (= N78), I188 (≠ V181), G189 (= G182), T190 (= T183), G191 (= G184), G192 (= G185), T193 (= T186), G233 (= G226), S277 (= S270), P304 (= P297)
P0A1E3 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; EC 2.5.1.47 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
54% identity, 97% coverage: 2:310/317 of query aligns to 1:313/323 of P0A1E3
- M1 (= M2) modified: Initiator methionine, Removed
- N72 (= N78) binding
- S273 (= S270) binding
6z4nAAA structure of oass complexed with upar inhibitor (see paper)
53% identity, 97% coverage: 2:310/317 of query aligns to 2:314/321 of 6z4nAAA
- binding pyridoxal-5'-phosphate: K43 (= K48), N73 (= N78), V177 (= V181), G178 (= G182), T179 (= T183), G180 (= G184), T182 (= T186), G230 (= G226), S274 (= S270), P301 (= P297)
- binding (1~{S},2~{S})-1-[(4-methylphenyl)methyl]-2-phenyl-cyclopropane-1-carboxylic acid: K43 (= K48), T70 (= T75), G72 (= G77), N73 (= N78), T74 (= T79), Q144 (= Q148), F145 (= F149), Q229 (= Q225), G230 (= G226), I231 (= I227), A233 (= A229)
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
53% identity, 97% coverage: 1:309/317 of query aligns to 1:308/322 of P47998
- K46 (= K48) modified: N6-(pyridoxal phosphate)lysine; mutation to A: No cysteine synthase activity.
- T74 (= T75) mutation to A: Strong reduction of cysteine synthase activity.; mutation to S: Reduction of cysteine synthase activity.
- S75 (= S76) mutation S->A,N,T: Strong reduction of cysteine synthase activity.
- N77 (= N78) binding ; mutation to A: Reduction of cysteine synthase activity.; mutation to D: Strong reduction of cysteine synthase activity.
- T78 (= T79) mutation T->A,S: Reduction of cysteine synthase activity.
- Q147 (= Q148) mutation Q->A,E: Strong reduction of cysteine synthase activity.
- H157 (= H158) mutation H->Q,N: Slight reduction of cysteine synthase activity.
- G162 (= G163) mutation to E: In old3-1; displays a early leaf death phenotype. Abolishes cysteine synthase activity.
- GTGGT 181:185 (= GTGGT 182:186) binding
- T182 (= T183) mutation T->A,S: Slight reduction of cysteine synthase activity.
- T185 (= T186) mutation T->A,S: Strong reduction of cysteine synthase activity.
- K217 (≠ Q218) mutation to A: Impaired interaction with SAT1.
- H221 (= H222) mutation to A: Impaired interaction with SAT1.
- K222 (≠ R223) mutation to A: Impaired interaction with SAT1.
- S269 (= S270) binding ; mutation to A: Strong reduction of cysteine synthase activity.; mutation to T: Reduction of cysteine synthase activity.
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
53% identity, 97% coverage: 3:309/317 of query aligns to 1:306/320 of 2isqA
- active site: K44 (= K48), S267 (= S270)
- binding pyridoxal-5'-phosphate: K44 (= K48), N75 (= N78), G177 (= G180), G179 (= G182), T180 (= T183), G181 (= G184), T183 (= T186), G223 (= G226), S267 (= S270), P294 (= P297)
- binding : T72 (= T75), S73 (= S76), G74 (= G77), T76 (= T79), G122 (= G125), M123 (= M126), K124 (≠ A127), G217 (≠ A220), P218 (≠ S221), H219 (= H222), Q222 (= Q225), G223 (= G226)
1z7yA Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant (see paper)
53% identity, 97% coverage: 3:309/317 of query aligns to 1:306/320 of 1z7yA
- active site: A44 (≠ K48), S267 (= S270)
- binding n-[(3-hydroxy-2-methyl-5-{[(trihydroxyphosphoranyl)oxy]methyl}pyridin-4-yl)methylene]methionine: G74 (= G77), N75 (= N78), T76 (= T79), Q145 (= Q148), I178 (≠ V181), G179 (= G182), T180 (= T183), G181 (= G184), T183 (= T186), G223 (= G226), S267 (= S270), P294 (= P297), S295 (≠ D298)
1d6sA Crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine (see paper)
54% identity, 96% coverage: 7:310/317 of query aligns to 7:312/322 of 1d6sA
- active site: A41 (≠ K48), G228 (= G226)
- binding methionine: T68 (= T75), N69 (≠ S76), N71 (= N78), T72 (= T79), Q142 (= Q148), F143 (= F149), G176 (= G182), G228 (= G226)
- binding pyridoxal-5'-phosphate: N71 (= N78), G176 (= G182), T177 (= T183), G178 (= G184), T180 (= T186), G228 (= G226), S272 (= S270), P299 (= P297)
7n2tA O-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound (see paper)
52% identity, 97% coverage: 3:309/317 of query aligns to 1:306/309 of 7n2tA
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
52% identity, 96% coverage: 5:309/317 of query aligns to 75:378/392 of P47999
Sites not aligning to the query:
- 61 modified: N-acetylalanine
Q93244 Cysteine synthase 1; O-acetylserine (thiol)-lyase 1; OAS-TL; EC 2.5.1.47 from Caenorhabditis elegans (see 2 papers)
53% identity, 94% coverage: 12:309/317 of query aligns to 14:310/341 of Q93244
- P75 (= P74) mutation to L: In n5537; severe loss of protein stability.
- A88 (= A87) mutation to V: In n5522; severe loss of protein stability.
- S144 (= S143) mutation to F: In mr26; susceptible to high levels of hydrogen sulfide.
- G181 (= G180) mutation to E: In n5521 and mr23; severe loss of protein stability. Susceptible to high levels of hydrogen sulfide.
- G183 (= G182) mutation to R: In n5515; severe loss of protein stability.
- G229 (= G228) mutation to E: In mr33; susceptible to high levels of hydrogen sulfide.
- R259 (≠ E258) mutation to K: In n5519; no loss of protein stability. No effect on enzyme activity.
- S272 (= S271) mutation to F: In mr29; susceptible to high levels of hydrogen sulfide.
- T295 (≠ A294) mutation to I: In mr39; susceptible to high levels of hydrogen sulfide.
1fcjA Crystal structure of oass complexed with chloride and sulfate (see paper)
53% identity, 93% coverage: 7:300/317 of query aligns to 7:302/302 of 1fcjA
- active site: K41 (= K48), G228 (= G226), S272 (= S270)
- binding pyridoxal-5'-phosphate: K41 (= K48), N71 (= N78), V175 (= V181), G176 (= G182), T177 (= T183), G178 (= G184), T180 (= T186), G228 (= G226), S272 (= S270), P299 (= P297)
- binding sulfate ion: G70 (= G77), T72 (= T79), Q142 (= Q148)
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
47% identity, 97% coverage: 5:310/317 of query aligns to 9:312/329 of 8b9wA
Query Sequence
>351380 FitnessBrowser__Btheta:351380
MMAKIANKLTDLVGNTPLMELSGYSGKYGLNQNIIAKLEAFNPAGSVKDRVALSMIEDAE
ARGALKPGATIIEPTSGNTGVGLAMVATIKGYHLILTMPETMSLERRNLLKALGAQIVLT
DGLGGMAASIAKAQELRDSIPGSVILQQFENPSNAAVHERTTGEEIWRDTDGEVAVFVAG
VGTGGTICGVARALKKHNPDVHIVAVEPASSPILAGGQAASHRIQGIGANFIPKLYDASV
VDEVIGVPDDEAIRAGRELAATEGLLAGISSGAAVYAARQLAQRPEFRNKKIVALLPDTG
ERYLSTELFAFDAYPLD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory