SitesBLAST
Comparing 351414 FitnessBrowser__Btheta:351414 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
7e1sC Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
38% identity, 96% coverage: 4:353/365 of query aligns to 3:363/366 of 7e1sC
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M94), A129 (= A119), G130 (= G120), L131 (= L121), I150 (= I140), I151 (≠ V141), S152 (= S142), E178 (= E168), H185 (= H175), Y280 (≠ M274), I324 (= I314), L328 (= L318)
- binding flavin mononucleotide: G25 (= G26), G26 (= G27), M27 (= M28), G28 (= G29), N102 (= N92), E178 (= E168), S182 (≠ A172), G183 (= G173), G223 (= G216), G224 (= G217), M244 (= M237), A245 (≠ G238), T246 (≠ S239), L249 (≠ V242), F342 (= F332), T343 (≠ A333)
- binding iron/sulfur cluster: C303 (= C297), N306 (≠ H300), C307 (= C301), V308 (≠ I302), C311 (= C305), G314 (vs. gap), A317 (vs. gap), C323 (= C313), I324 (= I314)
- binding : L131 (= L121), T133 (≠ L123), N134 (≠ D124), K155 (≠ R145), I159 (= I149), K162 (≠ D152), R163 (≠ K153), R167 (≠ N157)
7e1sA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
38% identity, 96% coverage: 4:353/365 of query aligns to 3:363/366 of 7e1sA
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M94), A129 (= A119), G130 (= G120), I150 (= I140), I151 (≠ V141), S152 (= S142), E178 (= E168), H185 (= H175), G187 (= G177), Y280 (≠ M274), L328 (= L318)
- binding flavin mononucleotide: G25 (= G26), G26 (= G27), M27 (= M28), G28 (= G29), N102 (= N92), L104 (≠ M94), E178 (= E168), G183 (= G173), G223 (= G216), G224 (= G217), Q243 (= Q236), M244 (= M237), A245 (≠ G238), T246 (≠ S239)
- binding iron/sulfur cluster: C303 (= C297), N306 (≠ H300), C307 (= C301), V308 (≠ I302), C311 (= C305), G314 (vs. gap), A317 (vs. gap), C323 (= C313), I324 (= I314)
7e1rA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp (see paper)
38% identity, 96% coverage: 4:353/365 of query aligns to 3:363/366 of 7e1rA
- binding flavin mononucleotide: G25 (= G26), G26 (= G27), M27 (= M28), G28 (= G29), N102 (= N92), L104 (≠ M94), E178 (= E168), G183 (= G173), G224 (= G217), Q243 (= Q236), M244 (= M237), A245 (≠ G238), T246 (≠ S239), F342 (= F332)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: G128 (= G118), A129 (= A119), G130 (= G120), E178 (= E168), H185 (= H175), G187 (= G177)
- binding iron/sulfur cluster: C303 (= C297), N306 (≠ H300), C307 (= C301), V308 (≠ I302), C311 (= C305), G314 (vs. gap), A317 (vs. gap), C323 (= C313), I324 (= I314)
7e1qA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori (see paper)
38% identity, 96% coverage: 4:353/365 of query aligns to 3:363/366 of 7e1qA
- binding flavin mononucleotide: G25 (= G26), G26 (= G27), M27 (= M28), G28 (= G29), N102 (= N92), L104 (≠ M94), E178 (= E168), S182 (≠ A172), G183 (= G173), G223 (= G216), G224 (= G217), M244 (= M237), A245 (≠ G238), T246 (≠ S239), F342 (= F332)
- binding iron/sulfur cluster: P277 (= P271), C303 (= C297), N306 (≠ H300), C307 (= C301), V308 (≠ I302), C311 (= C305), G314 (vs. gap), A317 (vs. gap), C323 (= C313), I324 (= I314)
7l00C Crystal structure of c. Difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
30% identity, 92% coverage: 17:353/365 of query aligns to 14:302/315 of 7l00C
- binding flavin mononucleotide: G23 (= G26), G24 (= G27), M25 (= M28), A26 (≠ G29), N74 (= N92), E142 (= E168), G146 (≠ A172), G147 (= G173), G174 (= G216), G175 (= G217), Q194 (= Q236), G196 (= G238), T197 (≠ S239), M281 (≠ F332), S285 (≠ N336)
- binding N-[6-(methylsulfonyl)-1,3-benzothiazol-2-yl]-2-[2-(1H-pyrrol-1-yl)-1,3-thiazol-4-yl]acetamide: A26 (≠ G29), M76 (= M94), G100 (= G118), A101 (= A119), G102 (= G120), V121 (≠ I140), P123 (≠ S142), H149 (= H175), L266 (≠ I302), M281 (≠ F332)
5gvhA Structure of fabk from thermotoga maritima (see paper)
28% identity, 95% coverage: 17:364/365 of query aligns to 10:307/311 of 5gvhA
- binding flavin mononucleotide: G19 (= G26), G20 (= G27), M21 (= M28), A22 (≠ G29), N70 (= N92), I72 (≠ M94), E138 (= E168), S142 (≠ A172), G143 (= G173), G170 (= G216), G171 (= G217), Q190 (= Q236), G192 (= G238), T193 (≠ S239), M275 (≠ F332), S279 (≠ N336)
4iqlA Crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors NADPH and fmn (see paper)
33% identity, 74% coverage: 19:287/365 of query aligns to 10:240/313 of 4iqlA
- binding flavin mononucleotide: G18 (= G27), M19 (= M28), V20 (= V30), N68 (= N92), S94 (≠ G118), E136 (= E168), A140 (= A172), G141 (= G173), G170 (= G216), G171 (= G217), Q190 (= Q236), G192 (= G238), T193 (≠ S239)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W21 (≠ G31), W21 (≠ G31), W25 (≠ S35), S44 (≠ L57), M45 (≠ L58), M45 (≠ L58), H46 (≠ Y59), N49 (≠ G73), H52 (≠ E76), H53 (≠ E77), Y73 (≠ L97), P74 (≠ S98), E75 (≠ N99), S202 (≠ D248)
Sites not aligning to the query:
2z6iB Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) (see paper)
29% identity, 95% coverage: 9:353/365 of query aligns to 1:302/321 of 2z6iB
- binding calcium ion: E137 (= E168), H144 (= H175), A158 (= A199), I161 (≠ A202)
- binding flavin mononucleotide: G18 (= G26), G19 (= G27), M20 (= M28), A21 (≠ G29), N69 (= N92), E137 (= E168), A141 (= A172), G142 (= G173), G169 (= G216), G170 (= G217), G191 (= G238), T192 (≠ S239), M281 (≠ F332)
4q4kA Crystal structure of nitronate monooxygenase from pseudomonas aeruginosa pao1 (see paper)
28% identity, 75% coverage: 9:281/365 of query aligns to 1:279/351 of 4q4kA
- binding flavin mononucleotide: A18 (≠ G26), P19 (≠ G27), M20 (= M28), L21 (≠ V30), N69 (= N92), F71 (≠ M94), H133 (vs. gap), Q176 (≠ E168), A180 (= A172), G181 (= G173), G182 (= G174), G217 (= G216), G218 (= G217), G239 (= G238), T240 (≠ S239)
Sites not aligning to the query:
Q9HWH9 Nitronate monooxygenase; NMO; Propionate 3-nitronate monooxygenase; P3N monooxygenase; EC 1.13.12.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 75% coverage: 9:281/365 of query aligns to 1:279/351 of Q9HWH9
5lsmA Crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1
27% identity, 73% coverage: 19:284/365 of query aligns to 9:275/339 of 5lsmA
- binding flavin mononucleotide: A16 (≠ G26), P17 (≠ G27), M18 (= M28), A19 (≠ G29), N67 (= N92), H123 (vs. gap), A170 (= A172), G171 (= G173), G207 (= G216), G208 (= G217), G229 (= G238), T230 (≠ S239)
Sites not aligning to the query:
4qitA Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
27% identity, 75% coverage: 9:281/365 of query aligns to 1:279/350 of 4qitA
- binding flavin mononucleotide: A18 (≠ G26), P19 (≠ G27), M20 (= M28), L21 (≠ V30), N69 (= N92), F71 (≠ M94), H133 (vs. gap), Q176 (≠ E168), A180 (= A172), G181 (= G173), G217 (= G216), G218 (= G217), M238 (= M237), G239 (= G238), T240 (≠ S239)
- binding nitroethane: F71 (≠ M94), G182 (= G174), S183 (≠ H175)
Sites not aligning to the query:
2z6jA Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor (see paper)
28% identity, 95% coverage: 9:353/365 of query aligns to 1:289/307 of 2z6jA
- binding calcium ion: A158 (= A199), I161 (≠ A202)
- binding flavin mononucleotide: G18 (= G26), G19 (= G27), M20 (= M28), A21 (≠ G29), N69 (= N92), E137 (= E168), A141 (= A172), G142 (= G173), G169 (= G216), G170 (= G217), G191 (= G238), T192 (≠ S239)
- binding 2-(4-(2-((3-(5-(pyridin-2-ylthio)thiazol-2-yl)ureido)methyl)-1h-imidazol-4-yl)phenoxy)acetic acid: N45 (≠ G54), M71 (= M94), L73 (≠ A96), A96 (= A119), G97 (= G120), V116 (≠ I140), P118 (≠ S142), L122 (≠ A146), E137 (= E168), H144 (= H175)
4qiuB Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
27% identity, 74% coverage: 13:281/365 of query aligns to 4:278/350 of 4qiuB
- binding flavin mononucleotide: A17 (≠ G26), P18 (≠ G27), M19 (= M28), L20 (≠ V30), N68 (= N92), F70 (≠ M94), H132 (vs. gap), Q175 (≠ E168), A179 (= A172), G180 (= G173), G181 (= G174), G216 (= G216), G217 (= G217), G238 (= G238), T239 (≠ S239)
- binding 1-nitropropane: L20 (≠ V30)
Sites not aligning to the query:
6bkaA Crystal structure of nitronate monooxygenase from cyberlindnera saturnus (see paper)
24% identity, 95% coverage: 13:357/365 of query aligns to 8:374/374 of 6bkaA
- binding 3,6,9,12,15,18,21,24,27,30,33,36-dodecaoxaoctatriacontane-1,38-diol: T34 (≠ A40), R37 (≠ N43), V67 (≠ R82), D69 (≠ K84)
- binding flavin mononucleotide: A21 (≠ G26), P22 (≠ G27), M23 (= M28), A24 (≠ G29), N77 (= N92), F79 (≠ M94), H147 (vs. gap), Q190 (≠ E168), A194 (= A172), G195 (= G173), G196 (= G174), G239 (= G216), G240 (= G217), G261 (= G238), T262 (≠ S239)
3bw2A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
23% identity, 73% coverage: 21:285/365 of query aligns to 9:279/347 of 3bw2A
- binding flavin mononucleotide: A14 (≠ G26), P15 (≠ G27), M16 (= M28), A17 (≠ G29), N66 (= N92), F68 (≠ M94), H124 (≠ G118), Q167 (≠ E168), A171 (= A172), G172 (= G173), G173 (= G174), G210 (= G216), G211 (= G217), G232 (= G238), T233 (≠ S239)
Sites not aligning to the query:
3bw3A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
22% identity, 73% coverage: 21:285/365 of query aligns to 9:279/346 of 3bw3A
- binding flavin mononucleotide: A14 (≠ G26), P15 (≠ G27), M16 (= M28), A17 (≠ G29), N66 (= N92), F68 (≠ M94), H124 (≠ G118), A171 (= A172), G172 (= G173), G173 (= G174), G210 (= G216), G211 (= G217), G232 (= G238), T233 (≠ S239)
- binding nitroethane: G18 (≠ V30), Y42 (≠ E68)
Sites not aligning to the query:
2gjnA Crystal structure of 2-nitropropane dioxygenase complexed with fmn and substrate (see paper)
25% identity, 65% coverage: 9:247/365 of query aligns to 2:208/324 of 2gjnA
- binding flavin mononucleotide: G20 (= G27), M21 (= M28), Q22 (≠ G29), T73 (≠ M94), K122 (≠ I140), C147 (≠ A172), A148 (≠ G173), S176 (≠ A215), G177 (= G216), N197 (≠ Q236), M198 (= M237), G199 (= G238), T200 (≠ S239)
- binding 2-nitropropane: G149 (= G174), H150 (= H175)
Sites not aligning to the query:
Q9I4V0 NADH:quinone reductase; EC 1.6.5.9 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
25% identity, 68% coverage: 1:247/365 of query aligns to 1:210/328 of Q9I4V0
Query Sequence
>351414 FitnessBrowser__Btheta:351414
MAKHRIKYMKSFFIGNIEIKVPVIQGGMGVGISLSGLASAVANEGGVGVISCAGLGLLYP
KEKGTYTEKCISGLKEEIRKSRMKTKGIIGVNVMVALSNYADMVRTAINEKIDVIFSGAG
LPLDLPSYLTTGSITKLVPIVSSSRAAKIICDKWQKNYNYLPDAIVVEGPKAGGHLGFKK
EQLQDQNYALDVLIPEVVAIAASYKEQKHIPVIAAGGISTGEDIAHFMELGASGVQMGSI
FVTTLECDASETFKEVYIHSKSEDVLIIESPVGMPGRAIDGEFIHSVNNGLEKPRKCSFH
CIKTCDYTKSPYCIIKALYNAAKGNMKKGYAFAGSNAFLADKISSVKEVMNTLEREFFLA
THKLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory