SitesBLAST
Comparing 351439 FitnessBrowser__Btheta:351439 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
37% identity, 98% coverage: 1:254/259 of query aligns to 1:254/262 of G9FRD7
- SSTRGI 13:18 (≠ GAAGGI 13:18) binding
- R38 (≠ L38) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ SA 63:64) binding
- N90 (= N90) binding
- T145 (≠ S145) binding
- Y158 (= Y158) binding ; binding
- K162 (= K162) binding
- IGTRA 191:195 (≠ VLTPA 191:195) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
37% identity, 98% coverage: 2:254/259 of query aligns to 1:253/261 of 5epoA
- active site: G16 (= G17), T144 (≠ S145), I152 (≠ A153), Y157 (= Y158), K161 (= K162), R193 (≠ P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G13), T14 (≠ A15), R15 (≠ G16), G16 (= G17), I17 (= I18), R37 (≠ L38), F61 (= F62), N62 (≠ S63), N89 (= N90), Y90 (≠ V91), G91 (= G92), Y157 (= Y158), K161 (= K162), P187 (= P188), G188 (= G189), I190 (≠ V191), T192 (= T193), R193 (≠ P194), A194 (= A195), A195 (= A196)
- binding taurochenodeoxycholic acid: T93 (= T94), T144 (≠ S145), G146 (≠ S147), R154 (≠ G155), Y157 (= Y158), G188 (= G189), N198 (= N199), M199 (≠ L200), F203 (≠ V204)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 97% coverage: 1:251/259 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N117), S139 (= S145), Q149 (≠ G155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (= D99), K98 (= K104), S139 (= S145), N146 (≠ D152), V147 (≠ A153), Q149 (≠ G155), Y152 (= Y158), F184 (≠ L190), M189 (≠ A196), K200 (≠ I207)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ L38), V59 (≠ F62), D60 (≠ S63), V61 (≠ A64), N87 (= N90), A88 (≠ V91), G89 (= G92), I90 (≠ G93), T137 (≠ V143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ L190), T185 (≠ V191), T187 (= T193), M189 (≠ A196)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
38% identity, 96% coverage: 3:250/259 of query aligns to 2:242/251 of H9XP47
- N15 (≠ G16) binding
- M17 (≠ I18) binding
- D36 (= D37) binding
- D60 (≠ S63) binding
- V61 (≠ A64) binding
- N87 (= N90) binding
- S138 (= S145) binding ; binding
- V139 (≠ I146) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (= S147) binding
- Y151 (= Y158) binding ; binding ; binding
- K155 (= K162) binding
- V184 (= V191) binding
- T186 (= T193) binding
- RDK 197:199 (≠ RNI 205:207) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 96% coverage: 3:250/259 of query aligns to 2:242/251 of 6vspA
- active site: G16 (= G17), S138 (= S145), Y151 (= Y158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ G16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (≠ L38), W37 (≠ L38), A38 (≠ S39), I59 (≠ F62), D60 (≠ S63), V61 (≠ A64), N87 (= N90), A88 (≠ V91), G89 (= G92), V90 (≠ P96), V110 (≠ L116), T136 (≠ V143), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), S182 (≠ G189), L183 (= L190), V184 (= V191), T186 (= T193), N187 (≠ P194), M188 (≠ A195), T189 (≠ A196)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
38% identity, 96% coverage: 3:250/259 of query aligns to 2:242/251 of 6xewA
- active site: G16 (= G17), S138 (= S145), Y151 (= Y158)
- binding r,3-hydroxybutan-2-one: S138 (= S145), S140 (= S147), Y151 (= Y158)
- binding s,3-hydroxybutan-2-one: S138 (= S145), Y151 (= Y158), S182 (≠ G189)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ G16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (≠ L38), W37 (≠ L38), A38 (≠ S39), I59 (≠ F62), D60 (≠ S63), V61 (≠ A64), N87 (= N90), A88 (≠ V91), G89 (= G92), V110 (≠ L116), T136 (≠ V143), S138 (= S145), Y151 (= Y158), K155 (= K162), S182 (≠ G189), L183 (= L190), V184 (= V191), T186 (= T193), N187 (≠ P194), M188 (≠ A195), T189 (≠ A196)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 96% coverage: 3:250/259 of query aligns to 4:244/252 of 6vspB
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
36% identity, 97% coverage: 2:251/259 of query aligns to 1:239/239 of 4nbtA
- active site: G16 (= G17), S132 (= S145), Y145 (= Y158), K149 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), K15 (≠ G16), G16 (= G17), L17 (≠ I18), D36 (= D37), L37 (= L38), L52 (≠ F62), N53 (≠ S63), V54 (≠ A64), N80 (= N90), A81 (≠ V91), G82 (= G92), I130 (≠ V143), S132 (= S145), Y145 (= Y158), K149 (= K162), P177 (= P188), G178 (= G189), I180 (≠ V191), T182 (= T193)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
37% identity, 96% coverage: 4:252/259 of query aligns to 3:244/244 of 7krmC
- active site: G18 (= G17), S140 (= S145), Y155 (= Y158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (= L38), A60 (≠ F62), N61 (≠ S63), V62 (≠ A64), N88 (= N90), V111 (≠ L116), S140 (= S145), Y155 (= Y158), K159 (= K162), I188 (≠ V191), T190 (= T193)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
35% identity, 97% coverage: 2:251/259 of query aligns to 3:253/254 of 4fn4A
- active site: G18 (= G17), S144 (= S145), Y157 (= Y158), K161 (= K162), S202 (≠ E203)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ G16), G18 (= G17), I19 (= I18), E38 (≠ D37), L39 (= L38), R43 (= R42), A63 (≠ F62), D64 (≠ S63), V65 (≠ A64), N91 (= N90), G93 (= G92), I94 (vs. gap), T142 (≠ V143), S144 (= S145), Y157 (= Y158), K161 (= K162), P187 (= P188), V190 (= V191), T192 (= T193), N193 (≠ P194), I194 (≠ A195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 95% coverage: 4:250/259 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G17), S142 (= S145), Y155 (= Y158), K159 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ G16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ L38), A61 (≠ F62), D62 (≠ S63), T63 (≠ A64), N89 (= N90), A90 (≠ V91), M140 (≠ V143), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), A186 (≠ G189), Y187 (≠ L190), I188 (≠ V191), L192 (≠ A196)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
32% identity, 95% coverage: 3:249/259 of query aligns to 2:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (≠ G16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (≠ A64), N89 (= N90), A91 (≠ G92), S94 (≠ D95), I142 (≠ V143), S143 (≠ A144), S144 (= S145), Y157 (= Y158), K161 (= K162), P187 (= P188), H188 (≠ G189), I190 (≠ V191), I194 (≠ A195)
2zatA Crystal structure of a mammalian reductase (see paper)
33% identity, 95% coverage: 2:248/259 of query aligns to 1:246/251 of 2zatA
- active site: G16 (= G17), S142 (= S145), L152 (≠ G155), Y155 (= Y158), K159 (= K162), K200 (≠ E203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G13), T14 (≠ A15), D15 (≠ G16), G16 (= G17), I17 (= I18), S36 (≠ D37), R37 (≠ L38), K38 (≠ S39), N41 (≠ R42), H62 (≠ S63), N89 (= N90), A91 (≠ G93), V140 (= V143), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), G186 (= G189), I188 (≠ V191), T190 (= T193), F192 (≠ A195), S193 (≠ A196)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
33% identity, 95% coverage: 2:248/259 of query aligns to 29:274/279 of Q8WNV7
- 37:61 (vs. 10:34, 40% identical) binding
- F177 (≠ D152) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ G155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y158) active site, Proton acceptor
- K187 (= K162) binding
- N196 (≠ Y171) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 96% coverage: 4:251/259 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S145), Q152 (≠ G155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (≠ G16), G16 (= G17), I17 (= I18), N35 (≠ A36), Y36 (vs. gap), N37 (≠ D37), G38 (≠ L38), S39 (= S39), N63 (≠ S63), V64 (≠ A64), N90 (= N90), A91 (≠ V91), I93 (≠ G93), I113 (≠ L116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (≠ V191), T190 (= T193)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
33% identity, 97% coverage: 1:250/259 of query aligns to 1:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S145), H147 (≠ G155), Y150 (= Y158), L188 (≠ A196), L246 (= L249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ A15), S16 (≠ G16), G17 (= G17), I18 (= I18), R38 (≠ L38), R39 (≠ S39), D60 (≠ S63), V61 (≠ A64), N87 (= N90), S88 (≠ V91), G89 (= G92), V110 (≠ L116), T135 (≠ V143), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), A182 (≠ L190), I183 (≠ V191), T185 (= T193), S187 (≠ A195)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
34% identity, 95% coverage: 3:248/259 of query aligns to 8:249/255 of 1ahiA
- active site: G22 (= G17), S146 (= S145), M156 (≠ G155), Y159 (= Y158), K163 (= K162)
- binding glycochenodeoxycholic acid: S146 (= S145), A148 (≠ S147), N151 (≠ T150), Y159 (= Y158), A196 (= A195), V200 (≠ N199)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G13), A21 (≠ G16), G22 (= G17), I23 (= I18), D42 (= D37), I43 (≠ L38), D68 (≠ S63), I69 (≠ A64), N95 (= N90), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I192 (≠ V191), T194 (= T193), A196 (= A195)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 95% coverage: 3:248/259 of query aligns to 8:249/255 of P0AET8
- I23 (= I18) binding
- DI 42:43 (≠ DL 37:38) binding
- DI 68:69 (≠ SA 63:64) binding
- N95 (= N90) binding
- G99 (≠ T94) binding
- S146 (= S145) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ T150) binding
- Y159 (= Y158) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K162) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ VLT 191:193) binding
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
34% identity, 95% coverage: 3:248/259 of query aligns to 8:249/253 of 1ahhA
- active site: G22 (= G17), S146 (= S145), M156 (≠ G155), Y159 (= Y158), K163 (= K162)
- binding nicotinamide-adenine-dinucleotide: G18 (= G13), A21 (≠ G16), D42 (= D37), I43 (≠ L38), C67 (≠ F62), D68 (≠ S63), I69 (≠ A64), N95 (= N90), G97 (= G92), T145 (≠ A144), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I192 (≠ V191)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
32% identity, 97% coverage: 1:250/259 of query aligns to 1:247/249 of 4bmsF
- active site: S137 (= S145), H147 (≠ G155), Y150 (= Y158), K154 (= K162), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ A15), S16 (≠ G16), I18 (= I18), R38 (≠ L38), R39 (≠ S39), A59 (≠ F62), D60 (≠ S63), V61 (≠ A64), N87 (= N90), S88 (≠ V91), G89 (= G92), V110 (≠ L116), S137 (= S145), Y150 (= Y158), K154 (= K162), G181 (= G189), I183 (≠ V191), T185 (= T193), I187 (≠ A195)
Query Sequence
>351439 FitnessBrowser__Btheta:351439
MKRFENKVVVITGAAGGIGEATTRRIVSEGGKVVIADLSQERADKLAAELTQAGADVRPI
YFSATELQSCKELVDFAMKEYGQIDVLINNVGGTDPKRDLNIEKLDIDYFDEVFHLNLCC
TMYLSQQVIPIMTTHGGGNIVNVASISGLTADANGTLYGASKAGVINLTKYIATQMGKKN
IRCNAVAPGLVLTPAALDNLNEEVRNIFLGQCATPYLGEPEDVAATIAFLASNDARYITG
QTIVVDGGLTIHNPTVELS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory