Comparing 351497 FitnessBrowser__Btheta:351497 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
50% identity, 98% coverage: 6:753/763 of query aligns to 6:754/759 of P76558
6zngF Maeb full-length acetyl-coa bound state (see paper)
48% identity, 99% coverage: 7:763/763 of query aligns to 6:753/753 of 6zngF
6zn7A Maeb malic enzyme domain apoprotein (see paper)
64% identity, 52% coverage: 7:405/763 of query aligns to 5:403/405 of 6zn7A
6zn4A Maeb malic enzyme domain apoprotein (see paper)
64% identity, 52% coverage: 7:405/763 of query aligns to 5:403/406 of 6zn4A
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
47% identity, 49% coverage: 34:406/763 of query aligns to 29:387/387 of 5ceeA
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
46% identity, 55% coverage: 6:422/763 of query aligns to 2:416/438 of 2dvmA
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
50% identity, 45% coverage: 19:360/763 of query aligns to 18:353/383 of 2a9fA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
46% identity, 46% coverage: 19:369/763 of query aligns to 11:364/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
46% identity, 46% coverage: 19:369/763 of query aligns to 11:364/373 of 2haeB
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
31% identity, 41% coverage: 443:754/763 of query aligns to 20:325/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
30% identity, 44% coverage: 427:758/763 of query aligns to 5:339/339 of 6ioxA
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 42% coverage: 432:753/763 of query aligns to 394:709/714 of Q8ZND6
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
29% identity, 42% coverage: 431:753/763 of query aligns to 6:328/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
29% identity, 42% coverage: 431:753/763 of query aligns to 5:327/332 of 2af3C
P40927 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Columba livia (Rock dove) (see 3 papers)
27% identity, 37% coverage: 69:352/763 of query aligns to 138:476/557 of P40927
1gq2A Malic enzyme from pigeon liver (see paper)
27% identity, 37% coverage: 69:352/763 of query aligns to 137:475/555 of 1gq2A
Sites not aligning to the query:
6w49A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec010) (see paper)
26% identity, 44% coverage: 35:368/763 of query aligns to 82:503/543 of 6w49A
6w59A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec063) (see paper)
26% identity, 44% coverage: 35:368/763 of query aligns to 82:503/544 of 6w59A
6w56A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec062) (see paper)
26% identity, 44% coverage: 35:368/763 of query aligns to 82:503/544 of 6w56A
6w29A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec013) (see paper)
26% identity, 44% coverage: 35:368/763 of query aligns to 84:505/545 of 6w29A
>351497 FitnessBrowser__Btheta:351497
MAKITKEAALLYHSQGKPGKIEVVPTKPYSTQTDLSLAYSPGVAEPCLEIEKNPQDAYKY
TAKGNLVAVISNGTAVLGLGDIGALSGKPVMEGKGLLFKIYAGIDVFDIEVDEKDPEKFI
AAVKAIAPTFGGINLEDIKAPECFEIERRLKEELDIPVMHDDQHGTAIISSAGLVNALQV
AGKKIEDVKIVVNGAGASAVSCTKLYVSLGARLENIVMLDSKGVISKTRTDLNEQKRYFA
TDRTDIHTLEEAIKGADVFLGLSKGNVLSQDMVRSMAPMPIVFALANPTPEISYEDAMSA
RPDVLMATGRSDYPNQINNVIGFPYIFRGALDTQAKAINEEMKIAAVHAIANLAKQPVPD
VVNTAYHVNNLSFGPEYFIPKPVDPRLITEVSCAVAKAAMESGVARTEIKDWDAYCVHLR
ELMGYESKLTRQLYDTARRNPQRVVFAEGIHPNMLKAAVEAKAEGICHPILLGNDEAIGK
LAEELDLSLEGIEIVNLRHPDESERRERYSRILAEKRAREGFTYEEANDKMFERNYFGMM
MVETGDADAFITGLYTRYSNTIKVAKEVIGIQPGFNHFGTMHILNSKKGTYFLADTLINR
HPDTETLIDIAKLADKTVRFFNHTPVISMLSYSNFGADTSGSPVKVHGAVNYMQKEYPEL
AIDGEMQVNFAMNRELRDAKYPFTRLKGKDVNTLIFPNLSSANAGYKLLQAMDPDTEFIG
PIQMGLNKPIHFTDFESSVRDIVNITAVAVIDAIVVKKKNESR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory