SitesBLAST
Comparing 351590 FitnessBrowser__Btheta:351590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of 6pfkA
- active site: G11 (= G14), R72 (= R75), C73 (= C76), D103 (= D106), G104 (= G107), G124 (= G128), T125 (= T129), D127 (= D131), D129 (= D133), R171 (= R175)
- binding 2-phosphoglycolic acid: R21 (= R24), R25 (= R28), G58 (≠ S61), D59 (≠ N62), R154 (= R158), R211 (≠ K215), K213 (= K217)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of P00512
- RSVVR 21:25 (≠ RAVTR 24:28) binding
- D59 (≠ N62) binding
- RC 72:73 (= RC 75:76) binding
- D103 (= D106) binding
- TID 125:127 (= TID 129:131) binding in other chain
- R154 (= R158) binding in other chain
- R162 (= R166) binding
- MGR 169:171 (= MGR 173:175) binding in other chain
- GAE 185:187 (= GAE 189:191) binding in other chain
- R211 (≠ K215) binding in other chain
- KKH 213:215 (≠ KNS 217:219) binding in other chain
- E222 (= E226) binding in other chain
- R243 (= R250) binding
- HVQR 249:252 (≠ HLQR 256:259) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of 1mtoA
- active site: G11 (= G14), R72 (= R75), C73 (= C76), D103 (= D106), G104 (= G107), G124 (= G128), T125 (= T129), D127 (= D131), D129 (= D133), R171 (= R175)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D131), R162 (= R166), M169 (= M173), R171 (= R175), E222 (= E226), R243 (= R250), H249 (= H256), R252 (= R259)
4pfkA Phosphofructokinase. Structure and control (see paper)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of 4pfkA
- active site: G11 (= G14), R72 (= R75), C73 (= C76), D103 (= D106), G104 (= G107), G124 (= G128), T125 (= T129), D127 (= D131), D129 (= D133), R171 (= R175)
- binding adenosine-5'-diphosphate: S9 (= S12), Y41 (= Y44), R72 (= R75), C73 (= C76), F76 (= F79), K77 (≠ T80), G104 (= G107), G108 (= G111), R154 (= R158), G185 (= G189), R211 (≠ K215), G212 (≠ S216), K213 (= K217), H215 (≠ S219)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D131), M169 (= M173), E222 (= E226), H249 (= H256), R252 (= R259)
- binding magnesium ion: G185 (= G189), E187 (= E191)
3pfkA Phosphofructokinase. Structure and control (see paper)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of 3pfkA
- active site: G11 (= G14), R72 (= R75), C73 (= C76), D103 (= D106), G104 (= G107), G124 (= G128), T125 (= T129), D127 (= D131), D129 (= D133), R171 (= R175)
- binding phosphate ion: R154 (= R158), K213 (= K217), H249 (= H256), R252 (= R259)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
50% identity, 99% coverage: 4:326/326 of query aligns to 1:319/319 of 4i4iA
- active site: G11 (= G14), R72 (= R75), C73 (= C76), D103 (= D106), G104 (= G107), G124 (= G128), T125 (= T129), D127 (= D131), D129 (= D133), R171 (= R175)
- binding phosphoenolpyruvate: R21 (= R24), R25 (= R28), G58 (≠ S61), R154 (= R158), R211 (≠ K215), K213 (= K217), H215 (≠ S219)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
48% identity, 99% coverage: 4:326/326 of query aligns to 1:322/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
48% identity, 99% coverage: 4:326/326 of query aligns to 1:322/322 of Q2FXM8
- RC 72:73 (= RC 75:76) binding
- GDGS 102:105 (= GDGS 105:108) binding
- TID 127:129 (= TID 129:131) binding in other chain
- G150 (≠ D152) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A153) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R166) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 173:175) binding in other chain
- E224 (= E226) binding in other chain
- R245 (= R250) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HLQR 256:259) binding in other chain
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
50% identity, 93% coverage: 4:305/326 of query aligns to 1:300/318 of 5xz6A
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
50% identity, 93% coverage: 4:305/326 of query aligns to 1:300/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S12), Y41 (= Y44), C73 (= C76), F76 (= F79), K77 (≠ T80), G102 (= G105), D103 (= D106), G104 (= G107), S105 (= S108), R107 (≠ T110), G108 (= G111)
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
50% identity, 93% coverage: 4:305/326 of query aligns to 1:300/322 of 5xz7A
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
47% identity, 98% coverage: 4:324/326 of query aligns to 2:319/320 of 1pfkA
- active site: G12 (= G14), R73 (= R75), F74 (≠ C76), D104 (= D106), G105 (= G107), G125 (= G128), T126 (= T129), D128 (= D131), D130 (= D133), R172 (= R175)
- binding adenosine-5'-diphosphate: G11 (= G13), R22 (= R24), R26 (= R28), Y56 (≠ Q58), S59 (= S61), D60 (≠ N62), R73 (= R75), F74 (≠ C76), F77 (= F79), R78 (≠ T80), G103 (= G105), D104 (= D106), G105 (= G107), S106 (= S108), M108 (≠ T110), G109 (= G111), R155 (= R158), G213 (≠ S216), K214 (= K217), H216 (≠ S219)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G14), R73 (= R75), T126 (= T129), D128 (= D131), M170 (= M173), E223 (= E226), H250 (= H256), R253 (= R259)
- binding magnesium ion: G186 (= G189), E188 (= E191)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
47% identity, 98% coverage: 4:324/326 of query aligns to 2:319/320 of P0A796
- G12 (= G14) binding
- RGVVR 22:26 (≠ RAVTR 24:28) binding
- RYSVSD 55:60 (≠ SQNVSN 57:62) binding
- RF 73:74 (≠ RC 75:76) binding
- GDGS 103:106 (= GDGS 105:108) binding
- D104 (= D106) binding
- TID 126:128 (= TID 129:131) binding in other chain
- D128 (= D131) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R158) binding in other chain
- R163 (= R166) binding
- R172 (= R175) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAE 189:191) binding in other chain
- KKH 214:216 (≠ KNS 217:219) binding in other chain
- E223 (= E226) binding in other chain
- R244 (= R250) binding
- HIQR 250:253 (≠ HLQR 256:259) binding in other chain
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
45% identity, 97% coverage: 2:317/326 of query aligns to 13:362/780 of P17858
- G81 (= G68) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
45% identity, 97% coverage: 2:317/326 of query aligns to 3:352/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (= R75), C79 (= C76), T83 (= T80), G108 (= G105), G110 (= G107), S111 (= S108), G114 (= G111), I117 (= I114)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I130), D156 (= D131), R191 (= R166), M198 (= M173), R200 (= R175), E254 (= E226), R282 (= R250), H288 (= H256), R291 (= R259)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ T139), F298 (≠ H266), I301 (= I269), K305 (≠ R273), N331 (≠ D296)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 97% coverage: 2:317/326 of query aligns to 8:357/761 of 4xyjF
- active site: G20 (= G14), R83 (= R75), C84 (= C76), D114 (= D106), G158 (= G128), S159 (≠ T129), D161 (= D131), D163 (= D133), R205 (= R175)
- binding adenosine-5'-triphosphate: G20 (= G14), Y50 (= Y44), R83 (= R75), C84 (= C76), F87 (= F79), R88 (≠ T80), G113 (= G105), D114 (= D106), G115 (= G107), S116 (= S108), G119 (= G111), S159 (≠ T129)
- binding magnesium ion: G19 (= G13), G20 (= G14), G112 (= G104), D114 (= D106), G158 (= G128), D163 (= D133), R205 (= R175)
- binding phosphate ion: R30 (= R24), R34 (= R28), S69 (= S61), S70 (≠ N62), G219 (= G189), K250 (= K217)
Sites not aligning to the query:
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 97% coverage: 2:317/326 of query aligns to 10:359/768 of 4xyjA
- active site: G22 (= G14), R85 (= R75), C86 (= C76), D116 (= D106), G160 (= G128), S161 (≠ T129), D163 (= D131), D165 (= D133), R207 (= R175)
- binding adenosine-5'-triphosphate: G21 (= G13), G22 (= G14), Y52 (= Y44), C86 (= C76), F89 (= F79), R90 (≠ T80), G115 (= G105), D116 (= D106), G117 (= G107), S118 (= S108), G121 (= G111), S161 (≠ T129), R207 (= R175)
- binding magnesium ion: G21 (= G13), G22 (= G14), D116 (= D106), D165 (= D133)
- binding phosphate ion: R32 (= R24), R36 (= R28), S72 (≠ N62), G221 (= G189), K252 (= K217)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 97% coverage: 2:317/326 of query aligns to 6:355/737 of 4xykA
- active site: G18 (= G14), R81 (= R75), C82 (= C76), D112 (= D106), G156 (= G128), S157 (≠ T129), D159 (= D131), D161 (= D133), R203 (= R175)
- binding adenosine-5'-diphosphate: Y48 (= Y44), R81 (= R75), C82 (= C76), R86 (≠ T80), G111 (= G105), D112 (= D106), G113 (= G107), S114 (= S108)
- binding phosphate ion: R28 (= R24), R32 (= R28), S67 (= S61), K248 (= K217)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
42% identity, 97% coverage: 2:317/326 of query aligns to 22:371/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
42% identity, 95% coverage: 7:317/326 of query aligns to 3:347/731 of 4rh3A
- active site: G10 (= G14), R73 (= R75), C74 (= C76), D104 (= D106), G148 (= G128), S149 (≠ T129), D151 (= D131), D153 (= D133), R195 (= R175)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G13), R73 (= R75), C74 (= C76), F77 (= F79), R78 (≠ T80), G103 (= G105), D104 (= D106), G105 (= G107), S106 (= S108), G109 (= G111)
- binding phosphate ion: K240 (= K217)
Sites not aligning to the query:
Query Sequence
>351590 FitnessBrowser__Btheta:351590
MGTVKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYKGLVTGEIKEFKSQNV
SNIIQLGGTILKTARCKEFTTPEGRQLAYDNMKREGIDALVIIGGDGSLTGARIFAQEFD
VPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFL
ALNGAIASGAEAAIIPEFSTEVDQLEEFIKNGFRKSKNSSIVLVAESELTGGAMHYAERV
KNEYPQYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQRNVMIGIEHDEIVY
VPFSKAIKNDKPVKRDLVNVLKELSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory