Comparing 351598 FitnessBrowser__Btheta:351598 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
38% identity, 88% coverage: 55:434/434 of query aligns to 23:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
37% identity, 88% coverage: 55:434/434 of query aligns to 23:371/371 of 1ixeA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
33% identity, 88% coverage: 55:434/434 of query aligns to 25:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
33% identity, 88% coverage: 55:434/434 of query aligns to 25:370/370 of 6abxA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
34% identity, 87% coverage: 57:434/434 of query aligns to 25:371/372 of P39120
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
33% identity, 94% coverage: 28:434/434 of query aligns to 4:365/365 of 6s87D
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
35% identity, 88% coverage: 55:434/434 of query aligns to 23:370/371 of 1aj8A
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
32% identity, 88% coverage: 55:434/434 of query aligns to 62:426/426 of 2h12B
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 84% coverage: 55:417/434 of query aligns to 67:413/431 of P9WPD5
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
33% identity, 84% coverage: 55:418/434 of query aligns to 24:353/366 of P39119
2c6xA Structure of bacillus subtilis citrate synthase
33% identity, 84% coverage: 55:418/434 of query aligns to 23:352/363 of 2c6xA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
33% identity, 84% coverage: 55:417/434 of query aligns to 18:351/369 of 6abwA
3msuA Crystal structure of citrate synthase from francisella tularensis
31% identity, 84% coverage: 55:417/434 of query aligns to 72:403/415 of 3msuA
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
31% identity, 84% coverage: 55:417/434 of query aligns to 64:408/426 of 1owbA
3msuB Crystal structure of citrate synthase from francisella tularensis
31% identity, 84% coverage: 55:417/434 of query aligns to 72:414/426 of 3msuB
1a59A Cold-active citrate synthase (see paper)
31% identity, 83% coverage: 56:417/434 of query aligns to 27:364/377 of 1a59A
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
31% identity, 83% coverage: 56:417/434 of query aligns to 29:366/379 of O34002
Sites not aligning to the query:
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 84% coverage: 55:417/434 of query aligns to 65:409/427 of P0ABH7
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
31% identity, 84% coverage: 55:417/434 of query aligns to 64:408/426 of 1nxgA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
31% identity, 84% coverage: 55:417/434 of query aligns to 64:408/426 of 4jagA
>351598 FitnessBrowser__Btheta:351598
MKEATRIDNELFPKFDVKRGLRNEDGTGVLVGLTKIGNVVGYERIPGGGLKPIPGKLFYR
GYDVEDISHAIIKEKRFGFEEVAYLLLSGRLPDKEELASFRELINDNMALEQKTKMNIIE
LEGNNIMNILSRSVLEMYRFDPDADDTSRDNLMRQSIDLISKFPTIIAYAYNMLRHATFG
RSLHIRHPQEKLSIAENFLYMLKKDYTELDARTLDLLLILQAEHGGGNNSTFTVRVTSST
GTDTYSAIAAGIGSLKGPLHGGANIQVADMFHHLQENIKDWKSVDEIDTYFTRMLNKEVY
NKTGLIYGIGHAVYTISDPRALLLKELARDLAREKGKEEEFAFLELLEERAIATFGRVKN
NGKTVSSNIDFYSGFVYEMIGLPQEIFTPLFAMARIVGWCAHRNEELNFEGKRIIRPAYK
NVLDDLAYIPIKKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory