SitesBLAST
Comparing 351599 BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d4vA Crystal structure of NAD dependent isocitrate dehydrogenase from acidithiobacillus thiooxidans (see paper)
60% identity, 97% coverage: 9:393/396 of query aligns to 16:426/427 of 2d4vA
- active site: Y158 (= Y149), K228 (= K219), D294 (= D259), D318 (= D283), D322 (= D287)
- binding citrate anion: T103 (= T94), S111 (= S102), N113 (= N104), R117 (= R108), R127 (= R118), R151 (= R142), Y158 (= Y149), K228 (= K219), I231 (= I222), D318 (= D283)
- binding nicotinamide-adenine-dinucleotide: I35 (≠ V28), P100 (= P91), L101 (= L92), E102 (≠ T93), T103 (= T94), N113 (= N104), N230 (= N221), I292 (= I257), N295 (≠ A260), I331 (= I296), E347 (= E314), T349 (= T316), H350 (= H317), G351 (= G318), T352 (= T319), A353 (= A320), D355 (≠ N322), A362 (≠ V329), N363 (= N330), D403 (= D370)
6c0eA Crystal structure of isocitrate dehydrogenase from legionella pneumophila with bound NADPH with an alpha-ketoglutarate adduct
59% identity, 99% coverage: 4:394/396 of query aligns to 16:419/419 of 6c0eA
- active site: Y163 (= Y149), K233 (= K219), D286 (= D259), D310 (= D283)
- binding (3~{S})-3-[(4~{S})-3-aminocarbonyl-1-[(2~{R},3~{R},4~{S},5~{R})-5-[[[[(2~{R},3~{R},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3-oxidanyl-4-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4~{H}-pyridin-4-yl]-2-oxidanylidene-pentanedioic acid: P105 (= P91), L106 (= L92), T108 (= T94), S116 (= S102), N118 (= N104), R122 (= R108), R132 (= R118), R156 (= R142), N235 (= N221), I284 (= I257), Q291 (≠ N264), R295 (≠ I268), D310 (= D283), I323 (= I296), E339 (= E314), H342 (= H317), G343 (= G318), T344 (= T319), A345 (= A320), K347 (≠ N322), Y348 (≠ I323), V354 (= V329), N355 (= N330), Y394 (≠ H369), D395 (= D370)
- binding glycine: S23 (≠ T11), L24 (= L12), H25 (≠ S13)
Q02NB5 Isocitrate dehydrogenase [NADP]; IDH; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see 2 papers)
59% identity, 99% coverage: 2:394/396 of query aligns to 13:418/418 of Q02NB5
- S115 (= S102) modified: Phosphoserine
- T193 (≠ P180) modified: Phosphothreonine
1isoA Isocitrate dehydrogenase: structure of an engineered NADP+--> NAD+ specificity-reversal mutant (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1isoA
- active site: Y158 (= Y149), K228 (= K219), D281 (= D259), D305 (= D283), D309 (= D287)
- binding nicotinamide-adenine-dinucleotide: I35 (≠ V28), H337 (= H317), G338 (= G318), A340 (= A320), D342 (≠ N322), A349 (≠ V329), N350 (= N330)
1bl5A Isocitrate dehydrogenase from e. Coli single turnover laue structure of rate-limited product complex, 10 msec time resolution (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1bl5A
- active site: Y158 (= Y149), K228 (= K219), D281 (= D259), D305 (= D283), D309 (= D287)
- binding 2-oxoglutaric acid: S111 (= S102), N113 (= N104), R117 (= R108), R127 (= R118)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H337 (= H317), G338 (= G318), A340 (= A320), Y343 (≠ I323), N350 (= N330), Y389 (≠ H369)
1ai3A Orbital steering in the catalytic power of enzymes: small structural changes with large catalytic consequences (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1ai3A
- active site: Y158 (= Y149), K228 (= K219), D281 (= D259), D305 (= D283), D309 (= D287)
- binding nicotinamide-(6-deamino-6-hydroxy-adenine)-dinucleotide phosphate: I35 (≠ V28), G99 (= G90), P100 (= P91), L101 (= L92), T102 (= T93), A335 (= A315), T336 (= T316), H337 (= H317), G338 (= G318), T339 (= T319), P341 (= P321), V349 (= V329), N350 (= N330), Y389 (≠ H369), D390 (= D370), R393 (= R373)
1ai2A Isocitrate dehydrogenase complexed with isocitrate, NADP+, and calcium (flash-cooled) (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1ai2A
- active site: Y158 (= Y149), K228 (= K219), D281 (= D259), D305 (= D283), D309 (= D287)
- binding isocitrate calcium complex: S111 (= S102), N113 (= N104), R117 (= R108), R127 (= R118), Y158 (= Y149), D305 (= D283), D309 (= D287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I35 (≠ V28), L101 (= L92), T102 (= T93), T336 (= T316), H337 (= H317), G338 (= G318), T339 (= T319), A340 (= A320), P341 (= P321), Y343 (≠ I323), V349 (= V329), N350 (= N330), Y389 (≠ H369), D390 (= D370), R393 (= R373)
4aj3A 3d structure of e. Coli isocitrate dehydrogenase in complex with isocitrate, calcium(ii) and NADP - the pseudo-michaelis complex (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 13:416/416 of 4aj3A
- active site: Y160 (= Y149), K230 (= K219), D283 (= D259), D307 (= D283), D311 (= D287)
- binding calcium ion: D307 (= D283), D311 (= D287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P102 (= P91), L103 (= L92), T105 (= T94), N115 (= N104), I320 (= I296), E336 (= E314), H339 (= H317), G340 (= G318), T341 (= T319), A342 (= A320), Y345 (≠ I323), V351 (= V329), N352 (= N330), Y391 (≠ H369), D392 (= D370)
P08200 Isocitrate dehydrogenase [NADP]; IDH; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Escherichia coli (strain K12) (see 9 papers)
59% identity, 99% coverage: 3:394/396 of query aligns to 13:416/416 of P08200
- K100 (= K89) modified: N6-succinyllysine; mutation K->R,E: Abolishes enzymatic activity.
- T104 (= T93) binding
- S113 (= S102) binding ; modified: Phosphoserine; mutation S->A,T: Decreased enzyme activity. Loss of phosphorylation.; mutation S->D,E: Reduced affinity for isocitrate.; mutation to D: Loss of enzyme activity.
- N115 (= N104) binding
- R119 (= R108) binding
- R129 (= R118) binding
- K142 (= K131) modified: N6-acetyllysine
- R153 (= R142) binding
- Y160 (= Y149) Critical for catalysis; mutation to F: Nearly abolishes enzyme activity. No significant effect on substrate affinity.
- K230 (= K219) Critical for catalysis; mutation to M: Nearly abolishes enzyme activity and strongly reduces substrate affinity.
- K242 (= K231) modified: N6-succinyllysine; mutation to E: Strongly impairs enzymatic activity.; mutation to R: Impairs enzymatic activity.
- D307 (= D283) binding
- 339:345 (vs. 317:323, 71% identical) binding
- N352 (= N330) binding
- Y391 (≠ H369) binding
- R395 (= R373) binding
4ajaA 3d structure of e. Coli isocitrate dehydrogenase in complex with isocitrate, calcium(ii) and thionadp (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 12:415/415 of 4ajaA
- active site: Y159 (= Y149), K229 (= K219), D282 (= D259), D306 (= D283), D310 (= D287)
- binding calcium ion: D306 (= D283), D310 (= D287)
- binding 7-thionicotinamide-adenine-dinucleotide phosphate: T103 (= T93), T104 (= T94), H338 (= H317), G339 (= G318), T340 (= T319), A341 (= A320), Y344 (≠ I323), N351 (= N330), Y390 (≠ H369), D391 (= D370), R394 (= R373)
1hj6A Isocitrate dehydrogenase s113e mutant complexed with isopropylmalate, NADP+ and magnesium (flash-cooled) (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1hj6A
- active site: Y158 (= Y149), K228 (= K219), D281 (= D259), D305 (= D283), D309 (= D287)
- binding 3-isopropylmalic acid: E111 (≠ S102), R117 (= R108), R127 (= R118), R151 (= R142), Y158 (= Y149), D305 (= D283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P100 (= P91), L101 (= L92), T102 (= T93), N113 (= N104), I318 (= I296), G319 (= G297), H337 (= H317), G338 (= G318), T339 (= T319), A340 (= A320), Y343 (≠ I323), V349 (= V329), N350 (= N330), Y389 (≠ H369), D390 (= D370)
4ajcA 3d structure of e. Coli isocitrate dehydrogenase k100m mutant in complex with alpha-ketoglutarate, calcium(ii) and adenine nucleotide phosphate (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 12:415/415 of 4ajcA
- active site: Y159 (= Y149), K229 (= K219), D282 (= D259), D306 (= D283), D310 (= D287)
- binding adenosine-2'-5'-diphosphate: H338 (= H317), G339 (= G318), A341 (= A320), Y344 (≠ I323), V350 (= V329), N351 (= N330), Y390 (≠ H369), D391 (= D370)
- binding 2-oxoglutaric acid: S112 (= S102), R118 (= R108), R152 (= R142), Y159 (= Y149)
- binding calcium ion: D306 (= D283), D310 (= D287)
1cw4A Crystal structure of k230m isocitrate dehydrogenase in complex with alpha-ketoglutarate (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 12:415/415 of 1cw4A
- active site: Y159 (= Y149), M229 (≠ K219), D282 (= D259), D306 (= D283), D310 (= D287)
- binding 2-oxoglutaric acid: S112 (= S102), N114 (= N104), R118 (= R108), R152 (= R142), Y159 (= Y149), D306 (= D283)
- binding manganese (ii) ion: D306 (= D283), D310 (= D287)
- binding sulfate ion: V106 (= V96), G107 (= G97), G109 (= G99)
1cw1A Crystal structure of isocitrate dehydrogenase mutant k230m bound to isocitrate and mn2+ (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 12:415/415 of 1cw1A
1idcA Isocitrate dehydrogenase from e.Coli (mutant k230m), steady-state intermediate complex determined by laue crystallography (see paper)
59% identity, 99% coverage: 3:394/396 of query aligns to 11:414/414 of 1idcA
1groA Regulatory and catalytic mechanisms in escherichia coli isocitrate dehydrogenase: multiple roles for n115 (see paper)
59% identity, 99% coverage: 2:394/396 of query aligns to 10:414/414 of 1groA
2iv0A Thermal stability of isocitrate dehydrogenase from archaeoglobus fulgidus studied by crystal structure analysis and engineering of chimers (see paper)
50% identity, 98% coverage: 8:395/396 of query aligns to 18:410/412 of 2iv0A
1tyoA Isocitrate dehydrogenase from the hyperthermophile aeropyrum pernix in complex with etheno-NADP (see paper)
46% identity, 98% coverage: 10:396/396 of query aligns to 23:418/427 of 1tyoA
1xkdA Ternary complex of isocitrate dehydrogenase from the hyperthermophile aeropyrum pernix (see paper)
46% identity, 98% coverage: 10:396/396 of query aligns to 24:415/427 of 1xkdA
- active site: Y158 (= Y149), K225 (= K219), D279 (= D259), D303 (= D283), D307 (= D287)
- binding calcium ion: D303 (= D283), D307 (= D287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P105 (= P91), L106 (= L92), T108 (= T94), N114 (= N104), I277 (= I257), N280 (≠ A260), Q283 (= Q263), Q284 (≠ N264), R288 (≠ I268), G317 (= G297), E332 (= E314), H335 (= H317), G336 (= G318), T337 (= T319), A338 (= A320), Y341 (≠ I323), I347 (≠ V329), N348 (= N330), D389 (= D370), R392 (= R373)
2e5mA Crystal structure of isocitrate dehydrogenase from sulfolobus tokodaii strain 7 (see paper)
44% identity, 98% coverage: 3:392/396 of query aligns to 11:398/403 of 2e5mA
- active site: Y150 (= Y149), K217 (= K219), D268 (= D259), D292 (= D283), D296 (= D287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L99 (= L92), T101 (= T94), N105 (= N104), E321 (= E314), H324 (= H317), G325 (= G318), K329 (≠ N322), Y330 (≠ I323), N337 (= N330)
Query Sequence
>351599 BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file)
MNKITMQKDGTLSVPDVPVVPYITGDGVGAEVTPSMQSVVNAAVQKAYGGKRRIEWKEVL
AGERAFNETGSWLPDETMKAFQEYLIGIKGPLTTPVGGGIRSLNVALRQTLDLYVCLRPV
RWYQGVHSPVKAPEKVNMCVFRENTEDIYAGIEWEAGTPEAEKFYQFLKNEMGVTKVRFP
ETSSFGVKPVSREGTERLVRAACQYALDHHLPSVTLVHKGNIMKFTEGGFKKWGYELAQR
EFGDALADGRLVIKDCIADAFLQNTLLIPEEYSVIATLNLNGDYVSDQLAAMVGGIGIAP
GANINYKTGHAIFEATHGTAPNIAGKDVVNPCSIILSAVMMLEYLGWKEAAALIEKALEQ
SFLDARATHDLARFMPGGTSLSTTAFTREIVERIEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory