SitesBLAST
Comparing 351605 FitnessBrowser__Btheta:351605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
41% identity, 99% coverage: 8:564/565 of query aligns to 96:660/667 of P09342
- C161 (= C74) modified: Disulfide link with 307
- P194 (≠ G107) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V218) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
41% identity, 99% coverage: 8:564/565 of query aligns to 93:657/664 of P09114
- P191 (≠ G107) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W483) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 12:576/597 of 6demA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), I38 (= I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K228 (≠ E225), M264 (= M261), V291 (= V288), V407 (= V394), L432 (= L419), G433 (= G420), M435 (= M422), D460 (= D447), N487 (= N474), E489 (≠ Y476), Q490 (≠ L477), M492 (≠ N479), V493 (= V480), W496 (= W483), L518 (≠ I505), N523 (≠ D510), V524 (≠ I511)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M261), D289 (= D286), R290 (= R287), M492 (≠ N479), W496 (= W483), A567 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G217 (= G215), A218 (≠ Q216), G219 (= G217), N222 (≠ G221), T244 (= T241), L245 (= L242), Q246 (≠ L243), L262 (= L259), G284 (= G281), A285 (≠ M282), R286 (= R283), D288 (= D285), R290 (= R287), V291 (= V288), E317 (≠ D305), I318 (= I306), N322 (≠ E310), D336 (= D324), V337 (≠ C325), M412 (= M399), G430 (= G417)
- binding magnesium ion: D460 (= D447), N487 (= N474), E489 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V394), G408 (= G395), Q409 (= Q396), H410 (≠ N397), M435 (= M422), G459 (= G446), D460 (= D447), A461 (≠ G448), S462 (≠ G449), M465 (= M452), N487 (= N474), E489 (≠ Y476), Q490 (≠ L477), G491 (= G478), M492 (≠ N479), V493 (= V480)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 12:576/597 of 6delA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), I38 (= I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K228 (≠ E225), M264 (= M261), V291 (= V288), V407 (= V394), L432 (= L419), G433 (= G420), M435 (= M422), D460 (= D447), N487 (= N474), E489 (≠ Y476), Q490 (≠ L477), M492 (≠ N479), V493 (= V480), W496 (= W483), L518 (≠ I505), N523 (≠ D510), V524 (≠ I511)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D286), R290 (= R287), W496 (= W483)
- binding flavin-adenine dinucleotide: R161 (= R156), G217 (= G215), A218 (≠ Q216), G219 (= G217), N222 (≠ G221), T244 (= T241), L245 (= L242), Q246 (≠ L243), L262 (= L259), G284 (= G281), A285 (≠ M282), R286 (= R283), D288 (= D285), R290 (= R287), V291 (= V288), E317 (≠ D305), I318 (= I306), N322 (≠ E310), D336 (= D324), V337 (≠ C325), M412 (= M399), G430 (= G417)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V394), G408 (= G395), Q409 (= Q396), H410 (≠ N397), G433 (= G420), M435 (= M422), G459 (= G446), D460 (= D447), A461 (≠ G448), S462 (≠ G449), M465 (= M452), N487 (= N474), E489 (≠ Y476), Q490 (≠ L477), G491 (= G478), M492 (≠ N479), V493 (= V480)
- binding magnesium ion: D460 (= D447), N487 (= N474), E489 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V394), G408 (= G395), Q409 (= Q396), H410 (≠ N397), G433 (= G420), M435 (= M422), G459 (= G446), D460 (= D447), A461 (≠ G448), S462 (≠ G449), M465 (= M452), N487 (= N474), E489 (≠ Y476), Q490 (≠ L477), G491 (= G478), M492 (≠ N479), V493 (= V480)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 10:572/593 of 6deoA
- active site: Y31 (= Y27), G33 (= G29), G34 (= G30), A35 (≠ S31), I36 (= I32), E57 (= E54), T80 (= T77), F119 (= F116), Q120 (= Q117), E121 (= E118), K169 (= K166), K224 (≠ E225), M260 (= M261), V287 (= V288), V403 (= V394), L428 (= L419), G429 (= G420), M431 (= M422), D456 (= D447), N483 (= N474), E485 (≠ Y476), Q486 (≠ L477), M488 (≠ N479), V489 (= V480), W492 (= W483), L514 (≠ I505), N519 (≠ D510), V520 (≠ I511)
- binding flavin-adenine dinucleotide: R159 (= R156), G213 (= G215), A214 (≠ Q216), G215 (= G217), N218 (≠ G221), T240 (= T241), L241 (= L242), Q242 (≠ L243), L258 (= L259), G280 (= G281), A281 (≠ M282), R282 (= R283), D284 (= D285), R286 (= R287), V287 (= V288), E313 (≠ D305), I314 (= I306), N318 (≠ E310), D332 (= D324), V333 (≠ C325), M408 (= M399), G426 (= G417)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (= M261), D285 (= D286), R286 (= R287), M488 (≠ N479), W492 (= W483)
- binding magnesium ion: D456 (= D447), N483 (= N474), E485 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V394), G404 (= G395), Q405 (= Q396), H406 (≠ N397), G429 (= G420), M431 (= M422), G455 (= G446), D456 (= D447), A457 (≠ G448), S458 (≠ G449), M461 (= M452), N483 (= N474), E485 (≠ Y476), Q486 (≠ L477), G487 (= G478), M488 (≠ N479), V489 (= V480)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 14:578/599 of 6denA
- active site: Y35 (= Y27), G37 (= G29), G38 (= G30), A39 (≠ S31), I40 (= I32), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K230 (≠ E225), M266 (= M261), V293 (= V288), V409 (= V394), L434 (= L419), G435 (= G420), M437 (= M422), D462 (= D447), N489 (= N474), E491 (≠ Y476), Q492 (≠ L477), M494 (≠ N479), V495 (= V480), W498 (= W483), L520 (≠ I505), N525 (≠ D510), V526 (≠ I511)
- binding flavin-adenine dinucleotide: R163 (= R156), G219 (= G215), A220 (≠ Q216), G221 (= G217), N224 (≠ G221), T246 (= T241), L247 (= L242), Q248 (≠ L243), L264 (= L259), G286 (= G281), A287 (≠ M282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (= V288), E319 (≠ D305), I320 (= I306), N324 (≠ E310), D338 (= D324), V339 (≠ C325), M414 (= M399), G432 (= G417)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M261), D291 (= D286), R292 (= R287), W498 (= W483)
- binding magnesium ion: D462 (= D447), N489 (= N474), E491 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V394), G410 (= G395), Q411 (= Q396), H412 (≠ N397), G435 (= G420), M437 (= M422), G461 (= G446), D462 (= D447), A463 (≠ G448), S464 (≠ G449), N489 (= N474), E491 (≠ Y476), Q492 (≠ L477), G493 (= G478), M494 (≠ N479), V495 (= V480)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 14:579/600 of 6derA
- active site: Y35 (= Y27), G37 (= G29), G38 (= G30), A39 (≠ S31), I40 (= I32), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K231 (≠ E225), M267 (= M261), V294 (= V288), V410 (= V394), L435 (= L419), G436 (= G420), M438 (= M422), D463 (= D447), N490 (= N474), E492 (≠ Y476), Q493 (≠ L477), M495 (≠ N479), V496 (= V480), W499 (= W483), L521 (≠ I505), N526 (≠ D510), V527 (≠ I511)
- binding flavin-adenine dinucleotide: R163 (= R156), G220 (= G215), A221 (≠ Q216), G222 (= G217), N225 (≠ G221), T247 (= T241), L248 (= L242), Q249 (≠ L243), L265 (= L259), H268 (= H262), G287 (= G281), A288 (≠ M282), R289 (= R283), D291 (= D285), R293 (= R287), V294 (= V288), E320 (≠ D305), I321 (= I306), N325 (≠ E310), G338 (= G323), D339 (= D324), V340 (≠ C325), Q414 (= Q398), M415 (= M399), G433 (= G417)
- binding Metosulam: R293 (= R287), M495 (≠ N479), W499 (= W483), A570 (≠ P554)
- binding magnesium ion: D463 (= D447), N490 (= N474), E492 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V394), G411 (= G395), Q412 (= Q396), H413 (≠ N397), G436 (= G420), M438 (= M422), G462 (= G446), D463 (= D447), A464 (≠ G448), S465 (≠ G449), N490 (= N474), E492 (≠ Y476), Q493 (≠ L477), G494 (= G478), M495 (≠ N479), V496 (= V480)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V394), G411 (= G395), Q412 (= Q396), H413 (≠ N397), G436 (= G420), M438 (= M422), G462 (= G446), D463 (= D447), A464 (≠ G448), S465 (≠ G449), M468 (= M452), N490 (= N474), E492 (≠ Y476), Q493 (≠ L477), G494 (= G478), V496 (= V480)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 14:580/601 of 6deqA
- active site: Y35 (= Y27), G37 (= G29), G38 (= G30), A39 (≠ S31), I40 (= I32), E61 (= E54), T84 (= T77), F123 (= F116), Q124 (= Q117), E125 (= E118), K173 (= K166), K232 (≠ E225), M268 (= M261), V295 (= V288), V411 (= V394), L436 (= L419), G437 (= G420), M439 (= M422), D464 (= D447), N491 (= N474), E493 (≠ Y476), Q494 (≠ L477), M496 (≠ N479), V497 (= V480), W500 (= W483), L522 (≠ I505), N527 (≠ D510), V528 (≠ I511)
- binding flavin-adenine dinucleotide: R163 (= R156), G221 (= G215), A222 (≠ Q216), G223 (= G217), N226 (≠ G221), T248 (= T241), L249 (= L242), Q250 (≠ L243), L266 (= L259), G288 (= G281), A289 (≠ M282), R290 (= R283), D292 (= D285), R294 (= R287), V295 (= V288), E321 (≠ D305), I322 (= I306), D340 (= D324), V341 (≠ C325), M416 (= M399), G434 (= G417)
- binding magnesium ion: D464 (= D447), N491 (= N474), E493 (≠ Y476)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M261), R294 (= R287), M496 (≠ N479), V497 (= V480), W500 (= W483), A571 (≠ P554)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V394), G412 (= G395), Q413 (= Q396), H414 (≠ N397), M439 (= M422), G463 (= G446), D464 (= D447), A465 (≠ G448), S466 (≠ G449), N491 (= N474), E493 (≠ Y476), Q494 (≠ L477), G495 (= G478), M496 (≠ N479), V497 (= V480)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 12:577/598 of 6desA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), I38 (= I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K229 (≠ E225), M265 (= M261), V292 (= V288), V408 (= V394), L433 (= L419), G434 (= G420), M436 (= M422), D461 (= D447), N488 (= N474), E490 (≠ Y476), Q491 (≠ L477), M493 (≠ N479), V494 (= V480), W497 (= W483), L519 (≠ I505), N524 (≠ D510), V525 (≠ I511)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (= M261), D290 (= D286), R291 (= R287), W497 (= W483)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G215), A219 (≠ Q216), G220 (= G217), N223 (≠ G221), T245 (= T241), L246 (= L242), Q247 (≠ L243), L263 (= L259), G285 (= G281), A286 (≠ M282), R287 (= R283), D289 (= D285), R291 (= R287), V292 (= V288), E318 (≠ D305), I319 (= I306), N323 (≠ E310), D337 (= D324), V338 (≠ C325), Q412 (= Q398), M413 (= M399), G431 (= G417)
- binding magnesium ion: D461 (= D447), N488 (= N474), E490 (≠ Y476)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V394), G409 (= G395), Q410 (= Q396), H411 (≠ N397), G434 (= G420), M436 (= M422), G460 (= G446), D461 (= D447), A462 (≠ G448), S463 (≠ G449), N488 (= N474), E490 (≠ Y476), Q491 (≠ L477), G492 (= G478), M493 (≠ N479), V494 (= V480)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
39% identity, 99% coverage: 6:563/565 of query aligns to 12:577/598 of 6depA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), I38 (= I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), K229 (≠ E225), M265 (= M261), V292 (= V288), V408 (= V394), L433 (= L419), G434 (= G420), M436 (= M422), D461 (= D447), N488 (= N474), E490 (≠ Y476), Q491 (≠ L477), M493 (≠ N479), V494 (= V480), W497 (= W483), L519 (≠ I505), N524 (≠ D510), V525 (≠ I511)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D286), R291 (= R287), M493 (≠ N479), W497 (= W483)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G215), A219 (≠ Q216), G220 (= G217), N223 (≠ G221), T245 (= T241), L246 (= L242), Q247 (≠ L243), L263 (= L259), G264 (= G260), G285 (= G281), A286 (≠ M282), R287 (= R283), D289 (= D285), R291 (= R287), V292 (= V288), E318 (≠ D305), I319 (= I306), N323 (≠ E310), D337 (= D324), V338 (≠ C325), M413 (= M399), G431 (= G417)
- binding magnesium ion: D461 (= D447), N488 (= N474), E490 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V394), G409 (= G395), Q410 (= Q396), H411 (≠ N397), G434 (= G420), M436 (= M422), G460 (= G446), D461 (= D447), A462 (≠ G448), S463 (≠ G449), M466 (= M452), N488 (= N474), E490 (≠ Y476), Q491 (≠ L477), G492 (= G478), M493 (≠ N479), V494 (= V480)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V394), G409 (= G395), Q410 (= Q396), H411 (≠ N397), G434 (= G420), M436 (= M422), G460 (= G446), D461 (= D447), A462 (≠ G448), S463 (≠ G449), M466 (= M452), N488 (= N474), E490 (≠ Y476), Q491 (≠ L477), G492 (= G478), M493 (≠ N479), V494 (= V480)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
40% identity, 99% coverage: 8:564/565 of query aligns to 99:663/670 of P17597
- A122 (≠ S31) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M33) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E54) binding
- S186 (= S96) binding
- P197 (≠ G107) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ G109) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q117) binding
- K220 (= K130) binding
- R246 (= R156) binding ; binding
- K256 (= K166) binding
- G308 (≠ Q216) binding
- TL 331:332 (= TL 241:242) binding
- C340 (≠ T250) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 259:262) binding
- GVRFD 371:375 (≠ GMRFD 281:285) binding
- DR 376:377 (= DR 286:287) binding
- DI 395:396 (= DI 305:306) binding
- DV 414:415 (≠ DC 324:325) binding
- QH 487:488 (≠ QN 396:397) binding
- GG 508:509 (= GG 417:418) binding
- GAM 511:513 (≠ GTM 420:422) binding
- D538 (= D447) binding
- DGS 538:540 (≠ DGG 447:449) binding
- N565 (= N474) binding
- NQHLGM 565:570 (≠ NNYLGN 474:479) binding
- H567 (≠ Y476) binding
- W574 (= W483) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P554) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M261), R292 (= R287), W489 (= W483), S568 (≠ P554)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), G426 (= G420), M428 (= M422), G452 (= G446), D453 (= D447), G454 (= G448), S455 (≠ G449), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), M263 (= M258), L264 (= L259), M266 (= M261), H267 (= H262), G286 (= G281), R288 (= R283), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417)
- binding magnesium ion: A37 (≠ S31), T82 (= T77), S83 (= S78), Q122 (= Q117), Y381 (≠ E375), D453 (= D447), M458 (= M452), Q461 (= Q455), N480 (= N474), H482 (≠ Y476), K533 (≠ R519)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/585 of 5k2oA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M261), R292 (= R287), W489 (= W483), S568 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), G286 (= G281), R288 (= R283), D290 (= D285), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), Q404 (= Q398), M405 (= M399), G423 (= G417)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), M428 (= M422), D453 (= D447), G454 (= G448), S455 (≠ G449), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), G426 (= G420), M428 (= M422), G452 (= G446), D453 (= D447), G454 (= G448), S455 (≠ G449), M458 (= M452), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), M266 (= M261), H267 (= H262), G286 (= G281), V287 (≠ M282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417)
- binding magnesium ion: F370 (vs. gap), D453 (= D447), M458 (= M452), Q461 (= Q455), N480 (= N474), H482 (≠ Y476), K533 (≠ R519)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M261), R292 (= R287), M485 (≠ N479), W489 (= W483), S568 (≠ P554)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 5wj1A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), M263 (= M258), L264 (= L259), G286 (= G281), R288 (= R283), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417), G424 (= G418)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M261), D291 (= D286), R292 (= R287), M485 (≠ N479), W489 (= W483), S568 (≠ P554)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), M428 (= M422), D453 (= D447), G454 (= G448), S455 (≠ G449), M458 (= M452), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 5k6tA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H262), R292 (= R287), M485 (≠ N479), W489 (= W483), S568 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), G286 (= G281), R288 (= R283), D290 (= D285), R292 (= R287), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), Q404 (= Q398), M405 (= M399), G423 (= G417)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), G426 (= G420), M428 (= M422), G452 (= G446), G454 (= G448), S455 (≠ G449), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 5k6rA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R287), W489 (= W483), S568 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), M266 (= M261), G286 (= G281), R288 (= R283), R292 (= R287), V293 (= V288), D310 (= D305), I311 (= I306), G328 (= G323), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), G426 (= G420), M428 (= M422), D453 (= D447), G454 (= G448), S455 (≠ G449), M458 (= M452), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 1z8nA
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K130), R161 (= R156), Y191 (vs. gap), R194 (≠ Y186), D291 (= D286), R292 (= R287), D312 (= D307), W489 (= W483), G569 (= G555)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), G265 (= G260), M266 (= M261), H267 (= H262), G286 (= G281), V287 (≠ M282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417), G424 (= G418)
- binding magnesium ion: D453 (= D447), N480 (= N474)
- binding thiamine diphosphate: V400 (= V394), G401 (= G395), Q402 (= Q396), H403 (≠ N397), G426 (= G420), M428 (= M422), G452 (= G446), G454 (= G448), S455 (≠ G449), N480 (= N474), H482 (≠ Y476), L483 (= L477), G484 (= G478), M485 (≠ N479), V486 (= V480)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 1yi1A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D286), R292 (= R287), W489 (= W483), S568 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), M263 (= M258), L264 (= L259), G265 (= G260), M266 (= M261), H267 (= H262), G286 (= G281), V287 (≠ M282), R288 (= R283), D290 (= D285), V293 (= V288), D310 (= D305), I311 (= I306), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417), G424 (= G418)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
40% identity, 99% coverage: 8:564/565 of query aligns to 14:578/582 of 1yi0A
- active site: Y33 (= Y27), G35 (= G29), G36 (= G30), A37 (≠ S31), S38 (≠ I32), E59 (= E54), T82 (= T77), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (= K166), M266 (= M261), V293 (= V288), V400 (= V394), G426 (= G420), M428 (= M422), D453 (= D447), N480 (= N474), H482 (≠ Y476), L483 (= L477), M485 (≠ N479), V486 (= V480), W489 (= W483), H558 (≠ E544)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D286), R292 (= R287), W489 (= W483), S568 (≠ P554)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G215), G223 (≠ Q216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (≠ L243), L264 (= L259), G265 (= G260), M266 (= M261), H267 (= H262), G286 (= G281), V287 (≠ M282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (= V288), D310 (= D305), I311 (= I306), G328 (= G323), D329 (= D324), V330 (≠ C325), M405 (= M399), G423 (= G417), G424 (= G418)
- binding magnesium ion: D453 (= D447), N480 (= N474), H482 (≠ Y476)
Query Sequence
>351605 FitnessBrowser__Btheta:351605
MSKDLITGAEAMMRSLEHQGVTTIFGYPGGSIMPTFDALYDHQNTLNHILVRHEQGAAHA
AQGYARVSGKVGVCLVTSGPGATNTITGIADAMIDSTPIVVIAGQVGTGFLGTDAFQEVD
LVGITQPIAKWSYQIRRAEDVAWAIARAFYIASSGRPGPVVLDFAKNAQVEKTKYEPTKQ
EFIRSYVPVPDTDEESVKAAAELINNAERPLVLVGQGVELGSAQEELRIFIEKADMPAGC
TLLGLSALPTDHPLNKGMLGMHGNLGPNINTNKCDVLIAVGMRFDDRVTGNLATYAKQAK
VIHFDIDPAEVNKNVKVDIAVLGDCKKTLAAVTGLLKKNRHTEWVDSFKEYEAVEEEKVI
RPELHPATDSLSMGEVVRAVSEATRHEAILVTDVGQNQMISARYFKYTRERSIVTSGGLG
TMGFGLPAAIGATFGRPDRTVCVFMGDGGLQMNIQELGTIMEQKAPVKIICLNNNYLGNV
RQWQAMFFNRRYSFTPMLNPDYMKIASAYDIPSKRVFSREELKAAIDEMLSTDGAFLLEA
CVVEEGNVLPMTPPGGSVNQMLLEC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory