Comparing 351628 FitnessBrowser__Btheta:351628 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 94% coverage: 4:239/251 of query aligns to 14:241/265 of P07821
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 86% coverage: 1:216/251 of query aligns to 1:219/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 86% coverage: 1:216/251 of query aligns to 2:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 86% coverage: 1:216/251 of query aligns to 2:220/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 86% coverage: 1:216/251 of query aligns to 2:220/344 of 6cvlD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 80% coverage: 1:201/251 of query aligns to 1:209/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
33% identity, 80% coverage: 1:201/251 of query aligns to 1:209/230 of 1l2tA
7zdbC If(heme/bound) conformation of cyddc in adp+pi(cydc)/atp(cydd) bound state (dataset-2) (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/554 of 7zdbC
Sites not aligning to the query:
7zdaC If(apo/asym) conformation of cyddc in adp+pi(cydc)/atp(cydd) bound state (dataset-2) (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/572 of 7zdaC
Sites not aligning to the query:
7zdkC If(apo/asym) conformation of cyddc in amp-pnp(cydc)/amp-pnp(cydd) bound state (dataset-8) (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/573 of 7zdkC
7zdfC If(heme/confined) conformation of cyddc in amp-pnp(cydd) bound state (dataset-4) (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/573 of 7zdfC
Sites not aligning to the query:
8ipsA Cryo-em structure of heme transporter cyddc from escherichia coli in the inward facing heme loading state (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/573 of 8ipsA
Sites not aligning to the query:
7zdtC Occ(apo/return) conformation of cyddc mutant (e500q.C) in atp(cydc) bound state (dataset-18) (see paper)
32% identity, 86% coverage: 2:216/251 of query aligns to 339:550/572 of 7zdtC
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
27% identity, 91% coverage: 1:228/251 of query aligns to 1:228/276 of Q5M243
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
30% identity, 98% coverage: 2:247/251 of query aligns to 5:237/249 of 4hluC
8g4cB Bceabs atpgs high res tm (see paper)
27% identity, 82% coverage: 13:218/251 of query aligns to 19:223/248 of 8g4cB
Sites not aligning to the query:
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
30% identity, 98% coverage: 2:247/251 of query aligns to 4:233/247 of 4zirB
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 87% coverage: 2:219/251 of query aligns to 7:210/353 of 1vciA
7tchB Bceab e169q variant atp-bound conformation (see paper)
27% identity, 82% coverage: 13:218/251 of query aligns to 18:222/245 of 7tchB
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
31% identity, 84% coverage: 17:227/251 of query aligns to 21:229/280 of 5x40A
Sites not aligning to the query:
>351628 FitnessBrowser__Btheta:351628
MIQLKDLTLGYEQRTLLEKVSAHITGGQLVALLGRNGTGKSTLLRAVMGLEKPQNGEIIL
HGNNIASLKPEELARNISFVTTDKVRIANLRCRDVVALGRAPYTNWLGQLQGEDKEKVDN
AMHLVGMDSYAEKTMDKMSDGECQRIMIARALAQDTPVILLDEPTAFLDLPNRYELCLLL
RKLTQKEGKCILFSTHDLDIALSLCDTIMLIDNPQLYSLPTNEMITSGHIERLFHNESIT
FDAQAMKIRIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory