Comparing 352022 FitnessBrowser__Btheta:352022 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
55% identity, 91% coverage: 1:217/238 of query aligns to 3:220/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
52% identity, 93% coverage: 1:222/238 of query aligns to 1:228/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
52% identity, 93% coverage: 1:222/238 of query aligns to 1:228/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
49% identity, 92% coverage: 1:219/238 of query aligns to 4:223/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
47% identity, 90% coverage: 1:215/238 of query aligns to 3:218/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
47% identity, 90% coverage: 1:215/238 of query aligns to 3:218/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 97% coverage: 1:230/238 of query aligns to 4:244/650 of 5ws4A
8g4cB Bceabs atpgs high res tm (see paper)
44% identity, 90% coverage: 1:215/238 of query aligns to 3:219/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
43% identity, 90% coverage: 1:215/238 of query aligns to 2:218/245 of 7tchB
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 95% coverage: 2:227/238 of query aligns to 1:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 95% coverage: 2:227/238 of query aligns to 1:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 95% coverage: 2:227/238 of query aligns to 1:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 95% coverage: 2:227/238 of query aligns to 1:224/242 of 2oljA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 90% coverage: 1:215/238 of query aligns to 5:221/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
41% identity, 90% coverage: 1:215/238 of query aligns to 2:218/222 of 7arlD
7mdyC Lolcde nucleotide-bound
41% identity, 90% coverage: 1:215/238 of query aligns to 2:218/226 of 7mdyC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 91% coverage: 1:217/238 of query aligns to 2:214/241 of 4u00A
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
40% identity, 90% coverage: 1:215/238 of query aligns to 4:220/229 of 7v8iD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 89% coverage: 7:217/238 of query aligns to 4:214/240 of 4ymuJ
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 83% coverage: 18:215/238 of query aligns to 17:214/223 of 2pclA
>352022 FitnessBrowser__Btheta:352022
MIKLTDINKTYNNGAPLHVLKGINLDIQRGEFVSIMGASGSGKSTLLNILGILDNYDTGD
YYLNNVLIKDLSETKAAEYRNRMIGFIFQSFNLISFKDAVENVALPLFYQGVSRKKRNAL
ALEYLDRLGLKEWAHHMPNEMSGGQKQRVAIARALITQPQIILADEPTGALDSKTSVEVM
QILKDLHRMGMTIVVVTHESGVANQTDKIIHIKDGIIERIEENLDHDASPFGQNGIMK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory