Comparing 352079 FitnessBrowser__Btheta:352079 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
35% identity, 88% coverage: 24:298/314 of query aligns to 19:283/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
35% identity, 88% coverage: 24:298/314 of query aligns to 17:281/285 of 3uf6A
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
27% identity, 91% coverage: 15:300/314 of query aligns to 14:333/339 of 6ioxA
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 58% coverage: 120:302/314 of query aligns to 531:710/714 of Q8ZND6
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
24% identity, 92% coverage: 15:303/314 of query aligns to 11:330/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
24% identity, 92% coverage: 15:303/314 of query aligns to 10:329/332 of 2af3C
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
31% identity, 46% coverage: 142:284/314 of query aligns to 166:307/325 of 1xcoD
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
28% identity, 59% coverage: 85:269/314 of query aligns to 532:710/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
29% identity, 43% coverage: 141:275/314 of query aligns to 594:723/759 of P76558
Sites not aligning to the query:
>352079 FitnessBrowser__Btheta:352079
MEPIQNFAQLTAHLKQQNRRKRIAVVCANDPNTEYAITRALEEGIAEFLMIGDSAILEKY
PALKQYPDYVKTIHIEDSDEAAREAVRIVREGGADILMKGIINTDNLLHAILDKEKGLLP
KGKILTHLAVMEIPTYHKLLFFSDAAVIPRPTLQQRIEMIWYAICTCRHFGIEQPRVALI
HCTEKVSAKFPHSLDYVNIVELAEAGEFGNVIIDGPLDVRTACEQASGDIKGIVSPINGQ
ADVLIFPNIESGNAFYKSVSLFANADMAGLLQGPICPVVLPSRSDSGLSKYYSIAMACLQ
VAGCECREKLNLNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory