SitesBLAST
Comparing 352275 FitnessBrowser__Btheta:352275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
53% identity, 99% coverage: 5:504/504 of query aligns to 2:502/502 of 6brlA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 2cv2A
- active site: K246 (= K263)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R9), A7 (= A11), S9 (= S13), G17 (= G21), I21 (≠ T25), E41 (= E45), Y187 (= Y201), R205 (= R219), A206 (≠ G220), E208 (= E222), W209 (= W223), L235 (= L251), L236 (= L252)
- binding : S9 (= S13), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V158), R163 (= R176), Y168 (≠ I181), E172 (≠ I185), V177 (= V190), K180 (= K193), S181 (= S194), Y187 (= Y201), E207 (= E221), E208 (= E222), W209 (= W223), V211 (≠ P225), R237 (≠ L253), K241 (≠ G257), L272 (= L305), M273 (≠ L306), G274 (= G307), E282 (= E315), S299 (= S332), P303 (≠ A336), V304 (≠ K337), K309 (= K342), W312 (= W345), R319 (vs. gap), P357 (≠ D388), R358 (= R389), R417 (≠ M450), Q432 (≠ N465), R435 (= R468), L442 (≠ G475), E443 (≠ K476), T444 (≠ G477), G446 (≠ H479), L447 (≠ M480), F448 (= F481)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 2cv1A
- active site: K246 (= K263)
- binding adenosine-5'-triphosphate: P8 (= P12), S9 (= S13), G17 (= G21), T18 (≠ G22), I21 (≠ T25), R47 (= R51), A206 (≠ G220), W209 (= W223), L235 (= L251), L236 (= L252)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R9), A7 (= A11), E41 (= E45), Y187 (= Y201), R205 (= R219), W209 (= W223)
- binding : S9 (= S13), E41 (= E45), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V158), R163 (= R176), V166 (= V179), E172 (≠ I185), V177 (= V190), K180 (= K193), S181 (= S194), Y187 (= Y201), E207 (= E221), E208 (= E222), W209 (= W223), V211 (≠ P225), R237 (≠ L253), K241 (≠ G257), K243 (= K260), M273 (≠ L306), G274 (= G307), S276 (≠ N309), E282 (= E315), S299 (= S332), P303 (≠ A336), V304 (≠ K337), K309 (= K342), W312 (= W345), R319 (vs. gap), P357 (≠ D388), R358 (= R389), R417 (≠ M450), L427 (≠ T460), Q432 (≠ N465), R435 (= R468), L442 (≠ G475), E443 (≠ K476), T444 (≠ G477), G446 (≠ H479), L447 (≠ M480), F448 (= F481)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 1n78A
- active site: K246 (= K263)
- binding glutamol-amp: R5 (= R9), A7 (= A11), P8 (= P12), S9 (= S13), G17 (= G21), T18 (≠ G22), I21 (≠ T25), E41 (= E45), Y187 (= Y201), N191 (= N205), R205 (= R219), A206 (≠ G220), E208 (= E222), W209 (= W223), L235 (= L251), L236 (= L252)
- binding : S9 (= S13), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V158), R163 (= R176), V166 (= V179), Y168 (≠ I181), E172 (≠ I185), V177 (= V190), K180 (= K193), S181 (= S194), Y187 (= Y201), E207 (= E221), E208 (= E222), W209 (= W223), L210 (= L224), V211 (≠ P225), R237 (≠ L253), K241 (≠ G257), M273 (≠ L306), G274 (= G307), E282 (= E315), R297 (= R330), P303 (≠ A336), V304 (≠ K337), K309 (= K342), W312 (= W345), R319 (vs. gap), P357 (≠ D388), R358 (= R389), R417 (≠ M450), L427 (≠ T460), Q432 (≠ N465), R435 (= R468), L442 (≠ G475), E443 (≠ K476), T444 (≠ G477), G446 (≠ H479), L447 (≠ M480), F448 (= F481)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 1j09A
- active site: K246 (= K263)
- binding adenosine-5'-triphosphate: H15 (= H19), E208 (= E222), L235 (= L251), L236 (= L252), K243 (= K260), I244 (≠ L261), S245 (= S262), K246 (= K263), R247 (= R264)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y187 (= Y201), N191 (= N205), R205 (= R219), W209 (= W223)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of P27000
- R358 (= R389) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
40% identity, 98% coverage: 6:500/504 of query aligns to 2:467/468 of 1g59A
- binding : D44 (= D48), R45 (≠ S49), A46 (≠ N50), R47 (= R51), P109 (= P113), V145 (= V158), R163 (= R176), V166 (= V179), E172 (≠ I185), V177 (= V190), K180 (= K193), S181 (= S194), D182 (= D196), E207 (= E221), E208 (= E222), R237 (≠ L253), K241 (≠ G257), T242 (≠ N258), K243 (= K260), M273 (≠ L306), G274 (= G307), E282 (= E315), S299 (= S332), L300 (≠ K333), P303 (≠ A336), V304 (≠ K337), K309 (= K342), W312 (= W345), R319 (vs. gap), P357 (≠ D388), R358 (= R389), R417 (≠ M450), K426 (≠ H459), L427 (≠ T460), Q432 (≠ N465), R435 (= R468), L442 (≠ G475), E443 (≠ K476), T444 (≠ G477), P445 (= P478), G446 (≠ H479), L447 (≠ M480), F448 (= F481)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
37% identity, 99% coverage: 6:504/504 of query aligns to 2:483/485 of 4griB
- active site: S9 (= S13), K253 (= K263)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y194 (= Y201), R212 (= R219), W216 (= W223)
- binding zinc ion: C105 (≠ A109), C107 (≠ D111), Y128 (≠ M135), C132 (≠ S139)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
37% identity, 99% coverage: 6:503/504 of query aligns to 4:469/488 of 8vc5A
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
34% identity, 99% coverage: 6:504/504 of query aligns to 103:563/564 of 3al0C
- active site: S110 (= S13), K335 (= K263)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R9), A108 (= A11), P109 (= P12), G118 (= G21), T122 (= T25), E142 (= E45), Y276 (= Y201), R294 (= R219), G295 (= G220), D297 (≠ E222), H298 (≠ W223), L324 (= L251), I325 (≠ L252), L333 (= L261)
- binding : T144 (= T47), D145 (= D48), R148 (= R51), Y208 (≠ F110), P213 (≠ A118), K252 (≠ R176), M255 (≠ V179), I266 (≠ V190), K269 (= K193), S270 (= S194), Y276 (= Y201), D297 (≠ E222), H298 (≠ W223), L299 (= L224), S300 (≠ P225), N301 (≠ S226), K304 (≠ L229), R330 (≠ N258), P332 (≠ K260), G363 (= G307), W364 (= W308), R365 (≠ N309), E370 (= E315), S387 (= S332), K389 (≠ S334), V391 (≠ A336), I392 (≠ K337), K397 (= K342), W400 (= W345), R407 (≠ Q352), E446 (≠ D388), K447 (≠ R389), Q453 (≠ E395), I457 (≠ V399), R509 (≠ M450), K520 (≠ N462), Q524 (≠ N465), R527 (= R468), V535 (≠ K476), T536 (≠ G477), G538 (≠ H479), L539 (≠ M480)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
36% identity, 94% coverage: 6:481/504 of query aligns to 2:457/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
36% identity, 94% coverage: 6:481/504 of query aligns to 3:458/485 of Q8DLI5
- R6 (= R9) binding
- Y192 (= Y201) binding
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 99% coverage: 5:503/504 of query aligns to 2:464/471 of P04805
- C98 (≠ A109) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ D111) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ M136) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ N138) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ L140) mutation to Q: No change in activity or in zinc content.
- H131 (≠ M142) mutation to Q: No change in activity or in zinc content.
- H132 (≠ S143) mutation to Q: No change in activity or in zinc content.
- C138 (≠ Y157) mutation to S: No change in activity or in zinc content.
- S239 (= S262) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
32% identity, 99% coverage: 5:503/504 of query aligns to 2:464/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
34% identity, 80% coverage: 4:408/504 of query aligns to 1:357/380 of 4g6zA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 53% coverage: 1:265/504 of query aligns to 11:243/308 of P27305
- E55 (= E45) binding
- Y182 (= Y201) binding
- R200 (= R219) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
32% identity, 51% coverage: 9:264/504 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S13), K229 (= K263)
- binding glutamic acid: R7 (= R9), A9 (= A11), S11 (= S13), E43 (= E45), Y170 (= Y201), R188 (= R219), L192 (≠ W223)
- binding zinc ion: C99 (≠ A109), C101 (≠ D111), Y113 (= Y128), C117 (≠ T132)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
34% identity, 53% coverage: 5:270/504 of query aligns to 10:255/455 of 3aiiA
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 43% coverage: 6:223/504 of query aligns to 202:404/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>352275 FitnessBrowser__Btheta:352275
MAERKVRVRFAPSPTGALHIGGVRTALYNYLFARQHGGDLIFRIEDTDSNRFVPGAEEYI
LESFKWLGIHFDEGVSFGGEHGPYRQSERREIYKKYVQILLDNDKAYIAFDTPEELDAKR
AEIANFQYDASTRGMMRNSLTMSKEEVDALIAEGKQYVVRFKIEPNEDVHVNDLIRGEVV
INSSILDDKVLYKSADELPTYHLANIVDDHLMEVSHVIRGEEWLPSAPLHVLLYRAFGWE
DTMPEFAHLPLLLKPEGNGKLSKRDGDRLGFPVFPLEWRPESGEVSSGYRESGYLPEAVI
NFLALLGWNPGNDQEVMSMDEMIKLFDIHRCSKSGAKFDYKKGIWFNHQYIQLKPNEEIA
ELFLPVLKEHGVEAPFEKVVTVVGMMKDRVSFIKELWDVCSFFFVAPAEYDEKTVKKRWK
EDSAKCMTELAEVIAGIEDFSIEGQEKVVMDWIAEKGYHTGNIMNAFRLTLVGEGKGPHM
FDISWVLGKEETLARMKRAVEVLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory