Comparing 352284 FitnessBrowser__Btheta:352284 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
62% identity, 100% coverage: 1:352/352 of query aligns to 1:348/348 of P00805
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
64% identity, 93% coverage: 26:352/352 of query aligns to 2:326/326 of 1ho3A
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
61% identity, 93% coverage: 26:352/352 of query aligns to 2:307/307 of 1jazA
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
61% identity, 93% coverage: 26:352/352 of query aligns to 2:306/306 of 7r5qA
6pa3A E. Coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asn at ph 7.0 (see paper)
64% identity, 93% coverage: 26:352/352 of query aligns to 10:334/334 of 6pa3A
Sites not aligning to the query:
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
55% identity, 93% coverage: 25:352/352 of query aligns to 1:328/328 of 5k45A
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
55% identity, 93% coverage: 25:352/352 of query aligns to 1:328/328 of 5k3oA
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
52% identity, 93% coverage: 26:352/352 of query aligns to 2:326/326 of 2wltA
2gvnA L-asparaginase from erwinia carotovora in complex with aspartic acid (see paper)
51% identity, 93% coverage: 26:352/352 of query aligns to 3:325/325 of 2gvnA
P06608 L-asparaginase; L-ASNase; L-asparagine amidohydrolase; EC 3.5.1.1 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 2 papers)
49% identity, 93% coverage: 26:352/352 of query aligns to 26:348/348 of P06608
1jsrA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-l-norleucine (see paper)
49% identity, 93% coverage: 26:352/352 of query aligns to 2:324/324 of 1jsrA
1jslA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-d-norleucine (see paper)
49% identity, 93% coverage: 26:352/352 of query aligns to 2:324/324 of 1jslA
1hg0A X-ray structure of the complex between erwinia chrysanthemi l- asparaginase and succinic acid (see paper)
49% identity, 93% coverage: 26:352/352 of query aligns to 5:327/327 of 1hg0A
7u6mC Albumin binding domain fused to a mutant of the erwinia asparaginase (see paper)
49% identity, 93% coverage: 26:352/352 of query aligns to 20:342/342 of 7u6mC
2hlnA L-asparaginase from erwinia carotovora in complex with glutamic acid (see paper)
50% identity, 93% coverage: 26:352/352 of query aligns to 3:308/308 of 2hlnA
6wywA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 4.5
46% identity, 93% coverage: 27:352/352 of query aligns to 3:317/317 of 6wywA
6wyyA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-glu at ph 6.5
46% identity, 93% coverage: 27:352/352 of query aligns to 4:315/315 of 6wyyA
6wyzA Crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5
46% identity, 93% coverage: 27:352/352 of query aligns to 3:312/312 of 6wyzA
1hfwA X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and l-glutamate (see paper)
47% identity, 93% coverage: 26:352/352 of query aligns to 3:307/307 of 1hfwA
1hg1A X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate (see paper)
47% identity, 93% coverage: 26:352/352 of query aligns to 2:306/306 of 1hg1A
>352284 FitnessBrowser__Btheta:352284
MKQIKKLGLVVVTLLLSATMAFAAKPNIHILATGGTIAGTGSSATGTSYTAGQVAIGALL
DAVPEIKDIANVTGEQIVRIGSQDMNDEVWLTLAKKINELLKRPDIDGIVITHGTDTMEE
TAYFLNLTVKSDKPVVLVGAMRPSTALSADGPLNLYNAVVTAAAKESKDKGVLVAMNGLI
LGAESVVKMNTVDVQTFQAPNSGALGYVLNGKVCYNQITLKKHTTQSVFDVTKLTSLPKV
GIVYSYSNIEADMMTPLLNNGYKGIIHAGVGNGNIHKNIFPSLIDARRKGIVVVRSSRVP
TGPTTLDAEVDDAKYQFVASQELNPQKSRVLLMLALTKTTDWKQIQEYFNEY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory