SitesBLAST
Comparing 352331 FitnessBrowser__Btheta:352331 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
42% identity, 96% coverage: 3:301/311 of query aligns to 2:299/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N183), T217 (= T218), G219 (= G220), A220 (≠ S221), G222 (= G223), F250 (= F252), N272 (= N274), G275 (≠ A277), A276 (= A278), T279 (≠ V281)
- binding magnesium ion: D242 (= D244), T244 (≠ I246), A278 (= A280), S287 (= S289)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
43% identity, 97% coverage: 2:302/311 of query aligns to 3:304/306 of 4xckA
- active site: A249 (= A247), A250 (= A248), G251 (= G249), D252 (= D250)
- binding adenosine-5'-diphosphate: T220 (= T218), G222 (= G220), S223 (= S221), V242 (= V240), T247 (= T245), A250 (= A248), F254 (= F252), H276 (≠ N274), A279 (= A277), V283 (= V281)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G39 (= G38), K40 (= K39), N43 (= N42), A95 (= A94), I107 (= I106), I109 (≠ V108), E140 (= E139), T248 (≠ I246), D252 (= D250)
6znxC Ribokinase from thermus species
39% identity, 96% coverage: 3:301/311 of query aligns to 2:264/265 of 6znxC
1gqtB Activation of ribokinase by monovalent cations (see paper)
40% identity, 96% coverage: 3:300/311 of query aligns to 6:304/307 of 1gqtB
- active site: A251 (= A247), A252 (= A248), G253 (= G249), D254 (= D250)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N183), T222 (= T218), G224 (= G220), S225 (= S221), A252 (= A248), G253 (= G249), H278 (≠ N274), A281 (= A277)
- binding cesium ion: D248 (= D244), I250 (= I246), A284 (= A280), R287 (= R283), S293 (= S289)
- binding alpha-D-ribofuranose: N13 (= N10), D15 (= D12), G41 (= G38), N45 (= N42), E142 (= E139), D254 (= D250)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 96% coverage: 3:300/311 of query aligns to 7:305/309 of P0A9J6
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
40% identity, 96% coverage: 3:300/311 of query aligns to 4:302/305 of 1rk2A
- active site: A249 (= A247), A250 (= A248), G251 (= G249), D252 (= D250)
- binding adenosine-5'-diphosphate: T220 (= T218), G222 (= G220), S223 (= S221), A250 (= A248), G251 (= G249), H276 (≠ N274), A279 (= A277)
- binding tetrafluoroaluminate ion: G213 (= G211), R215 (= R213)
- binding magnesium ion: D246 (= D244), A282 (= A280), R285 (= R283), S291 (= S289)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G38 (= G37), G39 (= G38), K40 (= K39), N43 (= N42), E140 (= E139), D252 (= D250)
6wjzA Crystal structure of human ribokinase in complex with ampcp
36% identity, 93% coverage: 3:291/311 of query aligns to 5:299/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N183), T222 (= T218), G224 (= G220), A225 (≠ S221), G227 (= G223), T243 (≠ G237), V246 (= V240), A254 (= A248), G255 (= G249), N282 (= N274), A285 (= A277), A286 (= A278), V289 (= V281)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
36% identity, 93% coverage: 3:291/311 of query aligns to 5:299/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N183), T222 (= T218), G224 (= G220), A225 (≠ S221), G227 (= G223), T243 (≠ G237), V246 (= V240), A254 (= A248), G255 (= G249), N282 (= N274), A285 (= A277), A286 (= A278), V289 (= V281)
- binding alpha-D-ribofuranose: D14 (= D12), G40 (= G38), K41 (= K39), N44 (= N42), A96 (= A94), E141 (= E139), D256 (= D250)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
36% identity, 93% coverage: 3:291/311 of query aligns to 5:299/317 of 5c41A
- active site: G253 (≠ A247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N183), T222 (= T218), G224 (= G220), A225 (≠ S221), G227 (= G223), V246 (= V240), G255 (= G249), N282 (= N274), A285 (= A277), A286 (= A278)
5c3yA Structure of human ribokinase crystallized with amppnp
36% identity, 93% coverage: 3:291/311 of query aligns to 4:298/306 of 5c3yA
- active site: G252 (≠ A247), A253 (= A248), G254 (= G249), D255 (= D250)
- binding amp phosphoramidate: T221 (= T218), G223 (= G220), V245 (= V240), T250 (= T245), G254 (= G249), N281 (= N274), A284 (= A277), A285 (= A278)
2fv7A Crystal structure of human ribokinase
36% identity, 93% coverage: 3:291/311 of query aligns to 4:298/308 of 2fv7A
- active site: G252 (≠ A247), A253 (= A248), G254 (= G249), D255 (= D250)
- binding adenosine-5'-diphosphate: N185 (= N183), T221 (= T218), G223 (= G220), G226 (= G223), T242 (≠ G237), V245 (= V240), A253 (= A248), G254 (= G249), N281 (= N274), A284 (= A277), A285 (= A278), V288 (= V281)
5byfA Crystal structure of human ribokinase in complex with amp
36% identity, 92% coverage: 7:291/311 of query aligns to 10:300/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
36% identity, 92% coverage: 7:291/311 of query aligns to 22:312/322 of Q9H477
6a8cA Ribokinase from leishmania donovani with adp (see paper)
34% identity, 95% coverage: 3:296/311 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G220), A246 (≠ S221), T271 (= T245), A274 (= A248), G275 (= G249), N300 (= N274), A303 (= A277)
- binding glycerol: D25 (= D12), S42 (≠ D29), S44 (= S31), G50 (= G37), G51 (= G38), N55 (= N42)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
34% identity, 95% coverage: 3:296/311 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G220), A246 (≠ S221), T271 (= T245), A274 (= A248), G275 (= G249), N300 (= N274), A303 (= A277), V307 (= V281)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42), N157 (≠ A138), I159 (= I140), E190 (= E171)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
34% identity, 95% coverage: 3:296/311 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N183), T243 (= T218), G245 (= G220), A246 (≠ S221), G248 (= G223), T271 (= T245), G273 (≠ A247), A274 (= A248), G275 (= G249), N300 (= N274), A303 (= A277), V307 (= V281)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
31% identity, 96% coverage: 3:300/311 of query aligns to 5:309/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N183), K225 (≠ T218), G227 (= G220), I246 (≠ L235), A248 (≠ G237), A257 (= A248), G258 (= G249), F261 (= F252), A286 (= A277), S287 (≠ A278)
- binding alpha-D-ribofuranose: N12 (= N10), D14 (= D12), G40 (= G38), K41 (= K39), N44 (= N42), E144 (= E139), D259 (= D250)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 96% coverage: 3:300/311 of query aligns to 71:375/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
31% identity, 96% coverage: 2:300/311 of query aligns to 5:320/320 of 6xk2A
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
36% identity, 91% coverage: 2:285/311 of query aligns to 3:269/287 of 3go6B
- active site: G227 (≠ A247), A228 (= A248), G229 (= G249), D230 (= D250)
- binding adenosine-5'-diphosphate: G200 (= G220), V201 (≠ S221), G203 (= G223), V220 (= V240), T225 (= T245), A228 (= A248), G229 (= G249), C258 (≠ N274), G261 (≠ A277), A262 (= A278), T265 (≠ V281)
- binding magnesium ion: D224 (= D244), A226 (≠ I246), A264 (= A280), V267 (≠ R283), G269 (= G285)
Sites not aligning to the query:
Query Sequence
>352331 FitnessBrowser__Btheta:352331
MKVVVIGSSNIDMVAQVNHLPAPGETVGDASFMQSLGGKGANQAVAAARLGGSVTFITSL
GNDMYAEILKKHFKKEGITTDYIIDDVNQPTGTALIFVADSGENCIAVAPGANYSLLPGS
IIHFSKVIDEADIIVMQAEIPYETIKRIALLAKQKGKKVLFNPAPACLIDEELMKAIDIL
VVNELEAAFISGIEYTGNNLEEIALSLLQAGARNAVITLGSQGVYMKNDKEIIQLPGYKV
NAIDTIAAGDTFCGALAVICAQREIDRDALSFANAAAAIAVTRSGAQPSIPTLDEVKHFM
LEKELALSFNF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory