SitesBLAST
Comparing 352338 FitnessBrowser__Btheta:352338 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
47% identity, 98% coverage: 7:519/523 of query aligns to 1:517/521 of 4ykgA
- active site: C345 (= C347), C348 (= C350), D349 (= D351)
- binding flavin-adenine dinucleotide: G221 (= G226), P222 (= P227), A223 (= A228), G242 (≠ A247), E243 (= E248), G247 (= G252), Q248 (= Q253), T252 (= T257), N257 (= N262), S289 (≠ K294), A290 (≠ I295), T322 (= T324), G323 (= G325), C348 (= C350), G487 (= G489), D488 (= D490), Q496 (= Q498), I497 (= I499)
- binding nicotinamide-adenine-dinucleotide: I361 (≠ V363), G364 (= G366), S366 (= S368), E385 (= E387), F386 (= F388), I449 (= I451), M467 (≠ P469), P493 (= P495)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
47% identity, 98% coverage: 7:519/523 of query aligns to 1:517/521 of 4ykfA
- active site: C345 (= C347), C348 (= C350), D349 (= D351)
- binding flavin-adenine dinucleotide: G221 (= G226), P222 (= P227), A223 (= A228), G242 (≠ A247), E243 (= E248), G247 (= G252), Q248 (= Q253), N257 (= N262), A290 (≠ I295), T322 (= T324), G323 (= G325), C348 (= C350), N454 (= N456), D488 (= D490), Q496 (= Q498), I497 (= I499)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (≠ V363), G364 (= G366), N365 (= N367), S366 (= S368), E385 (= E387), F386 (= F388), K391 (= K393), I449 (= I451), M467 (≠ P469)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
47% identity, 98% coverage: 7:519/523 of query aligns to 1:517/521 of P35340
- K53 (≠ M60) modified: N6-acetyllysine
- K354 (= K356) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
46% identity, 98% coverage: 7:519/523 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G226), P222 (= P227), A223 (= A228), E243 (= E248), G247 (= G252), Q248 (= Q253), N257 (= N262), S289 (≠ K294), A290 (≠ I295), T322 (= T324), G323 (= G325), W326 (= W328), C345 (= C347), D488 (= D490), K495 (= K497), Q496 (= Q498), I497 (= I499)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
39% identity, 58% coverage: 216:518/523 of query aligns to 3:304/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V254), L47 (≠ G259), N50 (= N262), C133 (= C347), C136 (= C350), D137 (= D351)
- binding flavin-adenine dinucleotide: V10 (≠ A223), G11 (= G224), A15 (= A228), D34 (≠ A247), K35 (≠ E248), G40 (= G252), L41 (≠ Q253), T42 (≠ V254), A45 (≠ T257), P46 (≠ V258), N50 (= N262), V82 (≠ Q292), T110 (= T324), G111 (= G325), S154 (= S368), Q241 (≠ N456), G275 (= G489), D276 (= D490), A283 (≠ K497), Q284 (= Q498), I285 (= I499)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
37% identity, 57% coverage: 218:514/523 of query aligns to 5:300/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G226), P14 (= P227), A15 (= A228), E34 (≠ A247), Q35 (≠ E248), G40 (= G252), Q41 (= Q253), T45 (= T257), N50 (= N262), V82 (≠ I295), T110 (= T324), G111 (= G325), Y114 (≠ W328), C136 (= C350), V242 (≠ N456), G275 (= G489), D276 (= D490), Q284 (= Q498), I285 (= I499)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
38% identity, 58% coverage: 213:513/523 of query aligns to 5:312/319 of 5u63B
- active site: C139 (= C347), C142 (= C350), D143 (= D351)
- binding flavin-adenine dinucleotide: G16 (= G224), S17 (≠ G225), G18 (= G226), P19 (= P227), A20 (= A228), T39 (≠ V246), G40 (≠ A247), Q42 (≠ R249), G45 (= G252), Q46 (= Q253), L47 (≠ V254), T50 (= T257), N55 (= N262), H87 (≠ R293), I88 (= I295), A115 (= A323), T116 (= T324), G117 (= G325), H248 (≠ L453), G288 (= G489), D289 (= D490), R296 (≠ K497), Q297 (= Q498), A298 (≠ I499), S301 (= S502)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R329), G157 (= G365), H179 (≠ E387), R180 (≠ F388), R181 (≠ M389), I246 (= I451), G247 (= G452), H248 (≠ L453), R296 (≠ K497)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 56% coverage: 218:509/523 of query aligns to 6:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G224), G14 (= G226), P15 (= P227), A16 (= A228), F34 (≠ V246), E35 (≠ A247), K36 (≠ E248), G41 (= G252), A42 (≠ Q253), V83 (≠ I295), T112 (= T324), G113 (= G325), G276 (= G489), D277 (= D490)
- binding nicotinamide-adenine-dinucleotide: G153 (= G365), G154 (= G366), S156 (= S368), Q175 (≠ E387), N176 (≠ F388), T181 (≠ K393), V238 (≠ I451)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
35% identity, 57% coverage: 216:514/523 of query aligns to 5:304/310 of 3f8pD
- active site: C135 (= C347), C138 (= C350), D139 (= D351)
- binding nicotinamide-adenine-dinucleotide: V12 (≠ A223), G13 (= G224), L14 (≠ G225), G15 (= G226), P16 (= P227), A17 (= A228), G36 (≠ A247), T38 (≠ R249), G41 (= G252), Q42 (= Q253), I82 (≠ R293), V83 (≠ I295), G111 (≠ A323), I112 (≠ T324), G113 (= G325), G277 (= G489), D278 (= D490)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
34% identity, 57% coverage: 217:514/523 of query aligns to 1:297/303 of 5mh4A
- active site: V34 (= V250), P35 (vs. gap), M39 (≠ V254), E44 (≠ G259), C130 (= C347), C133 (= C350), D134 (= D351)
- binding flavin-adenine dinucleotide: G10 (= G226), P11 (= P227), A12 (= A228), E31 (≠ A247), R32 (≠ E248), G37 (= G252), Q38 (= Q253), T42 (= T257), N47 (= N262), G77 (≠ R293), V79 (≠ I295), T107 (= T324), G108 (= G325), E155 (≠ A372), V239 (≠ N456), F242 (≠ V459), G272 (= G489), D273 (= D490), Q281 (= Q498), I282 (= I499)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (≠ V363), G147 (= G364), G148 (= G365), G149 (= G366), D150 (≠ N367), S151 (= S368), E154 (= E371), H170 (≠ E387), R171 (≠ F388), R172 (≠ M389), R176 (≠ K393), V234 (≠ I451), G235 (= G452), R280 (≠ K497), Q281 (= Q498)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
36% identity, 58% coverage: 213:513/523 of query aligns to 1:299/309 of 4gcmB
- active site: C133 (= C347), C136 (= C350), D137 (= D351)
- binding flavin-adenine dinucleotide: G11 (= G224), G13 (= G226), P14 (= P227), A15 (= A228), E34 (≠ A247), R35 (≠ E248), G40 (= G252), Q41 (= Q253), T45 (= T257), N50 (= N262), D81 (≠ K294), I82 (= I295), T110 (= T324), G111 (= G325), C136 (= C350), G275 (= G489), D276 (= D490), Q284 (= Q498), I285 (= I499)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ L331), G151 (= G365), G152 (= G366), D153 (≠ N367), S154 (= S368), E157 (= E371), R174 (≠ F388), R175 (≠ M389), R179 (≠ K393), Q181 (≠ D395), I237 (= I451)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
34% identity, 56% coverage: 217:511/523 of query aligns to 7:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V254), E50 (≠ G259), C141 (= C347), C144 (= C350), D145 (= D351)
- binding flavin-adenine dinucleotide: G16 (= G226), P17 (= P227), A18 (= A228), E37 (≠ A247), K38 (≠ E248), G43 (= G252), Q44 (= Q253), I45 (≠ V254), N53 (= N262), E85 (= E291), V86 (≠ Q292), T118 (= T324), G119 (= G325), C144 (= C350), G282 (= G489), D283 (= D490), Q291 (= Q498), L292 (≠ I499), S295 (= S502)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
34% identity, 57% coverage: 216:514/523 of query aligns to 5:302/308 of 3f8rA
- active site: C133 (= C347), C136 (= C350), D137 (= D351)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (≠ A223), G13 (= G224), L14 (≠ G225), G15 (= G226), P16 (= P227), A17 (= A228), E37 (= E248), T38 (≠ R249), G41 (= G252), Q42 (= Q253), I82 (≠ R293), V83 (≠ I295), G109 (≠ A323), I110 (≠ T324), G111 (= G325), R115 (= R329), L117 (= L331), D153 (≠ N367), S154 (= S368), E157 (= E371), R174 (≠ F388), R175 (≠ M389), Y184 (≠ L398), I236 (= I451), G275 (= G489), D276 (= D490), L282 (≠ V494), G283 (≠ P495), R285 (≠ K497)
3ishA Crystal structure of helicobacter pylori thioredoxin reductase
33% identity, 56% coverage: 219:512/523 of query aligns to 3:303/311 of 3ishA
- active site: C133 (= C347), C136 (= C350), D137 (= D351)
- binding flavin-adenine dinucleotide: G8 (= G224), G10 (= G226), P11 (= P227), A12 (= A228), E32 (= E248), K33 (≠ R249), G38 (= G252), Q39 (= Q253), I40 (≠ V254), I46 (= I260), N48 (= N262), V81 (≠ I295), T110 (= T324), C136 (= C350), G280 (= G489), D281 (= D490), K288 (= K497), Q289 (= Q498), V290 (≠ I499), A293 (≠ S502)
2q0kA Oxidized thioredoxin reductase from helicobacter pylori in complex with NADP+ (see paper)
33% identity, 56% coverage: 219:512/523 of query aligns to 3:303/310 of 2q0kA
- active site: C133 (= C347), C136 (= C350), D137 (= D351)
- binding flavin-adenine dinucleotide: G8 (= G224), G10 (= G226), P11 (= P227), A12 (= A228), E32 (= E248), K33 (≠ R249), G38 (= G252), Q39 (= Q253), I40 (≠ V254), N48 (= N262), V81 (≠ I295), T110 (= T324), G111 (= G325), C136 (= C350), G280 (= G489), D281 (= D490), K288 (= K497), Q289 (= Q498), V290 (≠ I499), A293 (≠ S502)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G151 (= G365), G152 (= G366), D153 (≠ N367), T154 (≠ S368), E157 (= E371), H173 (≠ E387), R174 (≠ F388), R175 (≠ M389), R179 (≠ K393), V237 (≠ I451), Y260 (≠ P469)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 58% coverage: 213:513/523 of query aligns to 2:301/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G224), G15 (= G226), P16 (= P227), A17 (= A228), E36 (≠ A247), R37 (≠ E248), G42 (= G252), Q43 (= Q253), T47 (= T257), N52 (= N262), G82 (≠ Q292), V84 (≠ K294), A111 (= A323), S112 (≠ T324), G113 (= G325), C138 (= C350), G277 (= G489), D278 (= D490), Q286 (= Q498), I287 (= I499)
- binding alpha-D-glucopyranose: R27 (= R238), D49 (≠ G259), K74 (≠ R284), F75 (≠ Y285), P122 (= P334), G123 (= G335), E126 (≠ D338), G129 (= G341), G131 (= G343), V132 (= V344), F143 (≠ Y355), E206 (= E418), N208 (≠ I420)
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
35% identity, 56% coverage: 219:513/523 of query aligns to 7:302/313 of 2a87A
- active site: F39 (≠ V250), L43 (≠ V254), D48 (≠ G259), C136 (= C347), C139 (= C350), D140 (= D351)
- binding flavin-adenine dinucleotide: G12 (= G224), S13 (≠ G225), G14 (= G226), P15 (= P227), A16 (= A228), F34 (≠ V246), E35 (vs. gap), G36 (≠ A247), G40 (= G251), G41 (= G252), A42 (≠ Q253), L43 (≠ V254), T46 (= T257), V49 (≠ I260), N51 (= N262), D83 (≠ K294), V84 (≠ I295), M113 (≠ T324), C139 (= C350), G278 (= G489), D279 (= D490), R286 (≠ K497), Q287 (= Q498), A288 (≠ I499), V289 (≠ I500)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L331), G155 (= G366), D156 (≠ N367), S157 (= S368), H176 (≠ E387), R177 (≠ F388), R178 (≠ M389), R182 (≠ K393), I239 (= I451), Y259 (≠ E471), R283 (≠ V494), R286 (≠ K497)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 56% coverage: 219:513/523 of query aligns to 16:311/335 of P9WHH1
- SGPA 22:25 (≠ GGPA 225:228) binding
- Y32 (= Y235) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 247:253, 25% identical) binding
- N60 (= N262) binding
- V93 (≠ I295) binding
- C145 (= C347) modified: Disulfide link with 148, Redox-active
- C148 (= C350) modified: Disulfide link with 145, Redox-active
- S166 (= S368) binding
- H185 (≠ E387) binding
- R191 (≠ K393) binding
- I248 (= I451) binding
- Y268 (≠ E471) binding
- D288 (= D490) binding
- R295 (≠ K497) binding
- RQAV 295:298 (≠ KQII 497:500) binding
7aawB Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 57% coverage: 216:513/523 of query aligns to 2:298/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G224), G12 (= G226), P13 (= P227), A14 (= A228), E33 (≠ A247), R34 (≠ E248), G39 (= G252), Q40 (= Q253), T44 (= T257), N49 (= N262), G79 (≠ Q292), D80 (≠ R293), V81 (≠ K294), S109 (≠ T324), G110 (= G325), Y113 (≠ W328), C135 (= C350), G274 (= G489), D275 (= D490), Q283 (= Q498), I284 (= I499)
- binding alpha-D-glucopyranose: D46 (≠ G259), E48 (= E261), G126 (= G341), G128 (= G343), D136 (= D351), A138 (≠ P353), F139 (= F354), F139 (= F354), F140 (≠ Y355)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G365), G151 (= G366), D152 (≠ N367), S153 (= S368), E156 (= E371), H172 (≠ E387), R173 (≠ F388), R174 (≠ M389), R178 (≠ K393), I236 (= I451)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
34% identity, 57% coverage: 216:514/523 of query aligns to 5:302/308 of 3f8dA
- active site: C133 (= C347), A136 (≠ C350), D137 (= D351)
- binding flavin-adenine dinucleotide: V12 (≠ A223), G13 (= G224), L14 (≠ G225), G15 (= G226), P16 (= P227), A17 (= A228), G36 (≠ A247), E37 (= E248), T38 (≠ R249), G41 (= G252), Q42 (= Q253), E45 (= E256), A46 (≠ T257), V49 (≠ I260), D51 (≠ N262), I82 (≠ R293), V83 (≠ I295), G109 (≠ A323), I110 (≠ T324), G111 (= G325), C133 (= C347), A136 (≠ C350), G275 (= G489), D276 (= D490), R285 (≠ K497), Q286 (= Q498), V287 (≠ I499)
Query Sequence
>352338 FitnessBrowser__Btheta:352338
MKGEREMLEPALKEQLKGIFAGLEADFTFDISVSASHESRAELLELLSDVAECSDHITCM
VNEGSGLKFTIGKNGKPTEITFRAIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKAL
KGPIHLVTYVSLTCTNCPDVVQALNAMTTLNPSITHEMVDGALYQDEVDALKIQGVPSVF
ADGKLLHVGRGEFGELLAKLEAQYGIDETKVETEVKEYDVIVAGGGPAGVSAAIYSARKG
LRVAIVAERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEQRKIEKVEL
AGKDKLVTTSVGEKFIAPALIIATGASWRKLNVPGENDYIGRGVAFCPHCDGPFYKGKQV
AVVGGGNSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVSSQTTEVI
GNGDKLTALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIVIDAHCRT
NVTGIYAAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGLIV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory