Comparing 352402 FitnessBrowser__Btheta:352402 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
38% identity, 69% coverage: 56:178/178 of query aligns to 127:247/261 of 6wyeA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
38% identity, 68% coverage: 56:176/178 of query aligns to 125:243/243 of 7ra4A
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
34% identity, 76% coverage: 41:176/178 of query aligns to 104:233/233 of 4n6bA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
33% identity, 76% coverage: 41:176/178 of query aligns to 111:243/243 of 4n69A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
35% identity, 69% coverage: 56:178/178 of query aligns to 129:249/272 of 3gvdI
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
41% identity, 53% coverage: 85:178/178 of query aligns to 149:242/258 of 8i04A
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
41% identity, 53% coverage: 85:178/178 of query aligns to 152:245/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
41% identity, 52% coverage: 85:176/178 of query aligns to 153:244/244 of 8i06A
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
38% identity, 52% coverage: 85:176/178 of query aligns to 149:240/258 of 4h7oA
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
40% identity, 53% coverage: 85:178/178 of query aligns to 153:246/262 of 1t3dA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
33% identity, 77% coverage: 40:176/178 of query aligns to 111:244/250 of 4hzdA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
32% identity, 88% coverage: 23:178/178 of query aligns to 15:183/186 of 4isxA
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
31% identity, 69% coverage: 56:178/178 of query aligns to 111:242/257 of 1ssqD
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
45% identity, 30% coverage: 126:178/178 of query aligns to 132:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
45% identity, 30% coverage: 126:178/178 of query aligns to 132:183/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
45% identity, 30% coverage: 126:178/178 of query aligns to 132:183/200 of 1krrA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 30% coverage: 126:178/178 of query aligns to 133:184/203 of P07464
Sites not aligning to the query:
P56287 Translation initiation factor eIF2B subunit epsilon; eIF2B GDP-GTP exchange factor subunit epsilon from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 39% coverage: 92:160/178 of query aligns to 342:417/678 of P56287
Sites not aligning to the query:
Q93S40 Polysialic acid O-acetyltransferase; Polysialyltransferase; PST; EC 2.3.1.- from Neisseria meningitidis (see paper)
40% identity, 30% coverage: 126:178/178 of query aligns to 139:191/215 of Q93S40
Sites not aligning to the query:
2wlgA Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
40% identity, 30% coverage: 126:178/178 of query aligns to 135:187/211 of 2wlgA
Sites not aligning to the query:
>352402 FitnessBrowser__Btheta:352402
MVTLKEYLNSDRIDYFPFGSKGYIMDWLLRTEQYWIRRYIRALRKEEFYMNYKRNKILQY
YFSRKKNLLGIRLGFFINAGCFDIGLKIYHYGSIIVNPKSRIGKNCTIHGNCCIGSKGTF
PDDSPVIGNNVDIGQNAQILGGIYIADGVKIGAGAVVTKSVLVPGVTVVGVPARIVEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory