Comparing 352404 FitnessBrowser__Btheta:352404 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 63% coverage: 70:195/201 of query aligns to 48:184/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 63% coverage: 70:195/201 of query aligns to 47:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 63% coverage: 70:195/201 of query aligns to 47:183/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 63% coverage: 70:195/201 of query aligns to 47:183/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
43% identity, 48% coverage: 100:195/201 of query aligns to 80:183/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
37% identity, 49% coverage: 98:195/201 of query aligns to 82:183/190 of 5u2kA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
34% identity, 67% coverage: 65:199/201 of query aligns to 151:283/307 of A1ADJ6
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 45% coverage: 105:194/201 of query aligns to 67:182/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
34% identity, 45% coverage: 105:194/201 of query aligns to 57:172/176 of 3ectA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 45% coverage: 105:194/201 of query aligns to 64:179/183 of 3nz2C
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
36% identity, 49% coverage: 96:194/201 of query aligns to 82:184/188 of 3igjC
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
44% identity, 42% coverage: 111:195/201 of query aligns to 158:242/258 of 8i04A
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
44% identity, 42% coverage: 111:195/201 of query aligns to 161:245/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
43% identity, 41% coverage: 111:193/201 of query aligns to 162:244/244 of 8i06A
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
40% identity, 49% coverage: 84:182/201 of query aligns to 25:134/141 of 7s45A
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
41% identity, 42% coverage: 111:195/201 of query aligns to 158:242/258 of 4h7oA
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
42% identity, 42% coverage: 111:195/201 of query aligns to 162:246/262 of 1t3dA
Sites not aligning to the query:
Q5KW03 Carbonic anhydrase; Gamma-carbonic anhydrase; Cag; EC 4.2.1.1 from Geobacillus kaustophilus (strain HTA426) (see paper)
37% identity, 41% coverage: 113:195/201 of query aligns to 51:142/182 of Q5KW03
Sites not aligning to the query:
3vnpA Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
37% identity, 41% coverage: 113:195/201 of query aligns to 52:143/171 of 3vnpA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
42% identity, 42% coverage: 111:195/201 of query aligns to 165:249/272 of 3gvdI
Sites not aligning to the query:
>352404 FitnessBrowser__Btheta:352404
MIFGFIAKIYRKYQEYIHPGIYVTRHGILYREKDCRYNVYPLQRLIVGKVWVGNIPSQEK
GRLILHANSELIVKGNFDIIGSTVVVLPDAKLILGSGYINFHSKLHCFNHIEIGENVIIS
ENVIIRDSDNHQITGGNSMFAPVIIKDNAWIGMSAIILKGVTVGEGAIVAAGSVVTKDVP
PHTIVAGVPARVIKKDVYYTI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory