Comparing 352470 FitnessBrowser__Btheta:352470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7txsA X-ray structure of the viob n-aetyltransferase from acinetobacter baumannii in the presence of a reaction intermediate (see paper)
31% identity, 37% coverage: 1:203/552 of query aligns to 4:203/209 of 7txsA
Sites not aligning to the query:
7txqA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in the present of tdp and acetyl-coenzymea (see paper)
31% identity, 37% coverage: 1:203/552 of query aligns to 4:203/209 of 7txqA
Sites not aligning to the query:
7txpA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose (see paper)
31% identity, 37% coverage: 1:203/552 of query aligns to 4:203/209 of 7txpA
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
34% identity, 30% coverage: 40:206/552 of query aligns to 45:208/216 of P71063
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
30% identity, 35% coverage: 10:203/552 of query aligns to 17:204/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
30% identity, 35% coverage: 10:203/552 of query aligns to 17:204/207 of 4ea8A
Sites not aligning to the query:
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
30% identity, 35% coverage: 10:203/552 of query aligns to 17:206/210 of 4eaaA
Sites not aligning to the query:
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
31% identity, 25% coverage: 64:203/552 of query aligns to 43:183/185 of 5tyhA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
31% identity, 25% coverage: 64:203/552 of query aligns to 50:190/192 of 5t2yA
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
31% identity, 25% coverage: 64:203/552 of query aligns to 51:191/193 of 3bsyA
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
31% identity, 25% coverage: 64:203/552 of query aligns to 53:193/195 of Q0P9D1
Sites not aligning to the query:
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
31% identity, 25% coverage: 64:203/552 of query aligns to 52:192/194 of 3bssA
Sites not aligning to the query:
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
31% identity, 25% coverage: 64:203/552 of query aligns to 52:192/194 of 2vheA
Sites not aligning to the query:
4m99A Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090 in complex with acetyl coenzyme a (see paper)
28% identity, 37% coverage: 1:205/552 of query aligns to 5:206/206 of 4m99A
7l82AAA Putative acetyl transferase protein (see paper)
28% identity, 36% coverage: 3:203/552 of query aligns to 6:214/216 of 7l82AAA
7l81AAA Putative acetyl transferase protein (see paper)
28% identity, 36% coverage: 3:203/552 of query aligns to 6:214/216 of 7l81AAA
7l7zAAA Putative acetyl transferase protein (see paper)
28% identity, 36% coverage: 3:203/552 of query aligns to 6:214/216 of 7l7zAAA
7l7yAAA Putative acetyl transferase protein (see paper)
28% identity, 36% coverage: 3:203/552 of query aligns to 6:214/217 of 7l7yAAA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
37% identity, 19% coverage: 106:211/552 of query aligns to 144:253/272 of 3gvdI
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
31% identity, 21% coverage: 108:225/552 of query aligns to 24:162/290 of 4mzuB
Sites not aligning to the query:
>352470 FitnessBrowser__Btheta:352470
MVIIGSKGCAKEILTALKWDNVEETVSLFDNINTDISDAYYDFPIIKSWNELEQHLKTDS
KVIIGVGGGQRREVLARKIACLGGVLTTFISQKALVGGYDNTIEPGVVILSGATITCNVS
IGQGTFINKSTVISHDVRIGRYCEVSPGAKVLGRAIIGDRTEIGANAVILPDVIVGADCK
IGAGAVVTRNIDSHTTVAGVPARSITKSSNNAFKLKSKIRNLLYHIRIADFRKLREYNHY
VFGKRKLMFLELLSHSWMYGASFENYYELQFFKKSRTECRQYLTSSLRHELTRQVNDPCE
ALVLKDKVRFSEVFEDILGRRVMTFDEIKRQMHDPYSISINEVVIKPIKGQAGQGIIFPM
QNFTSLRQLHDYVISTVKKPDEYLYEERIIQHSALNKLNPSSLNTLRIVTYYDESINKVD
VWSVVLRIGIKARTDNFATGGIAVLVDHRGVVCQPAIIKHPSGERFHIHPVSGEKITGCI
IPYYDQAIALAKQAAMRIPKVRSIGWDVAITETGPYMLEGNDNWCMTLFQLPGGEGLRHL
ANSVCNMFSVYE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory