Comparing 352609 FitnessBrowser__Btheta:352609 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
34% identity, 80% coverage: 112:548/548 of query aligns to 22:536/537 of Q96TU3
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
34% identity, 80% coverage: 112:548/548 of query aligns to 3:517/517 of 1y9gA
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
35% identity, 55% coverage: 117:420/548 of query aligns to 6:345/493 of 3rwkX
Sites not aligning to the query:
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
35% identity, 55% coverage: 117:420/548 of query aligns to 29:368/516 of O94220
Sites not aligning to the query:
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
36% identity, 58% coverage: 112:431/548 of query aligns to 30:366/534 of 8beqA
Sites not aligning to the query:
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
36% identity, 58% coverage: 112:431/548 of query aligns to 28:364/525 of 8betA
Sites not aligning to the query:
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
36% identity, 59% coverage: 112:432/548 of query aligns to 28:365/526 of 8besA
Sites not aligning to the query:
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
40% identity, 45% coverage: 114:361/548 of query aligns to 10:278/512 of 6s2bA
Sites not aligning to the query:
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
40% identity, 45% coverage: 114:361/548 of query aligns to 10:278/512 of 6s1tA
Sites not aligning to the query:
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
38% identity, 51% coverage: 116:397/548 of query aligns to 27:336/532 of P00724
Sites not aligning to the query:
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 79% coverage: 117:548/548 of query aligns to 3:431/432 of O33833
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
30% identity, 79% coverage: 117:548/548 of query aligns to 3:431/432 of 1w2tB
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
30% identity, 79% coverage: 117:548/548 of query aligns to 3:431/432 of 1w2tA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
28% identity, 75% coverage: 107:516/548 of query aligns to 27:488/526 of 3pijB
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
29% identity, 74% coverage: 113:516/548 of query aligns to 32:486/516 of 6nunA
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
28% identity, 81% coverage: 105:547/548 of query aligns to 14:488/490 of 7vcpA
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
35% identity, 47% coverage: 115:373/548 of query aligns to 23:289/464 of 7bwcA
Sites not aligning to the query:
2aeyA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol (see paper)
29% identity, 55% coverage: 117:415/548 of query aligns to 7:336/537 of 2aeyA
2addA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose (see paper)
29% identity, 55% coverage: 117:415/548 of query aligns to 7:336/537 of 2addA
4ffgA Crystal structure of levan fructotransferase from arthrobacter ureafaciens in complex with dfa-iv (see paper)
28% identity, 71% coverage: 120:509/548 of query aligns to 3:441/480 of 4ffgA
Sites not aligning to the query:
>352609 FitnessBrowser__Btheta:352609
MKTLSRTVLTLFVLSFSCLAAIAGEVSFKITKQYLNFPISHKENRGRMTFEVNGKPDLSV
VIRLAPDEAEYWVFKDVSAFKGKTIKITYDGNEKGLSKIYQSDEIEGQAELYKEKNRPQF
HFTTRRGWINDPNGLIYYEGEYHLFYQHNPFERDWENMHWGHAVSKDLIHWTELPDALYP
DHLGTMFSGSAVIDYDNTAGFNKGKTPAMVAAFTAASSDRQVQGIAYSLDKGRTFTKYDK
NPVINSKEKWNSQDTRDPKVFWYAPSKHWVLVLNERDGHSIYTSSNLKDWKYESHVTGFW
ECPELFELPVDGDKNHTKWVMYGATGTYMLGSFDGKVFTPEAGKYCYTTGSIYAAQTFTN
IPASDGRRIQIGWGRISHPGMPFNGMMMLPTELTLRTTKDGIRLVNVPVKEVESLCKPLR
SWKSLSSDEANRHLKEFYDADCLRIKTTIKLSHATDAGFNLFGQRMIGYDMNSNTLNGRF
YSPQDPTSMELSADIYIDRTSIEVFIDGGLYSYSMERRPDTNNREGLHFWGNRIEVKDLQ
VFSVESIW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory