Comparing 352790 FitnessBrowser__Btheta:352790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
44% identity, 80% coverage: 55:293/300 of query aligns to 54:298/318 of Q9Y315
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 76% coverage: 52:280/300 of query aligns to 12:236/259 of P0A6L0
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
42% identity, 76% coverage: 52:280/300 of query aligns to 10:234/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
42% identity, 76% coverage: 52:280/300 of query aligns to 10:234/248 of 5ekyA
Sites not aligning to the query:
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
41% identity, 76% coverage: 52:280/300 of query aligns to 10:234/248 of 6z9iB
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
41% identity, 76% coverage: 52:280/300 of query aligns to 13:237/252 of 1jcjA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
38% identity, 79% coverage: 52:289/300 of query aligns to 9:242/247 of 7p76A
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
35% identity, 78% coverage: 46:280/300 of query aligns to 2:232/246 of 3q2dA
8forA Crystal structure of kemp eliminase ke70-core with bound transition state analogue
36% identity, 74% coverage: 58:280/300 of query aligns to 16:234/249 of 8forA
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
28% identity, 78% coverage: 48:282/300 of query aligns to 7:212/222 of 3ngjD
Sites not aligning to the query:
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
30% identity, 65% coverage: 92:286/300 of query aligns to 35:203/211 of 1ub3A
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
29% identity, 69% coverage: 51:256/300 of query aligns to 9:197/226 of Q4ZMV1
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
27% identity, 65% coverage: 49:242/300 of query aligns to 14:207/273 of 3qyqA
Sites not aligning to the query:
>352790 FitnessBrowser__Btheta:352790
MEENSSQSNKYDAALAKYNTNLSDADIQARVADLIEKKVPENNTEEVKKLLFNCIDLTTL
NSTDSDESVMHFTEKVNEFDNEFPDMKNVAAICVYPNFADIVKNTLQVDGINIACVSGGF
PSSQTFIEVKVAETALAIADGADEIDIVISIGKFLSGDYETMCEEIQELKEVCKERHLKV
ILETGALKTASNIKKASILSMYSGADFIKTSTGKQQPAATPEAAYVMCEAIKEYYQKTNN
KIGFKPAGGINTVHDAIIYYTIVKEILGEEWLNNRLFRLGTSRLANLLLSDIKGEEIKFF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory