SitesBLAST
Comparing 352826 FitnessBrowser__Btheta:352826 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9FN05 Probable glucan 1,3-alpha-glucosidase; Glucosidase II subunit alpha; Protein PRIORITY IN SWEET LIFE 5; Protein RADIAL SWELLING 3; EC 3.2.1.84 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
35% identity, 84% coverage: 57:631/683 of query aligns to 229:834/921 of Q9FN05
- S517 (≠ Q325) mutation to F: In psl5-1; Compromised defense response induced by the bacterial elicitor elongation factor Tu (EF-Tu).
- S599 (= S411) mutation to F: In rsw3; temperature-sensitive radial swelling of roots and reduction in cellulose production.
5iefA Murine endoplasmic reticulum alpha-glucosidase ii with n-butyl-1- deoxynojirimycin (see paper)
34% identity, 90% coverage: 15:629/683 of query aligns to 139:776/858 of 5iefA
- binding (2r,3r,4r,5s)-1-butyl-2-(hydroxymethyl)piperidine-3,4,5-triol: W314 (≠ F182), D342 (= D210), W453 (= W318), D455 (= D320), F462 (≠ N327), R515 (= R384), W528 (= W397), D531 (= D400), F564 (= F433), H589 (= H458)
5ieeA Murine endoplasmic reticulum alpha-glucosidase ii with 1- deoxynojirimycin (see paper)
34% identity, 90% coverage: 15:629/683 of query aligns to 139:776/857 of 5ieeA
5iedA Murine endoplasmic reticulum alpha-glucosidase ii with castanospermine (see paper)
34% identity, 90% coverage: 15:629/683 of query aligns to 139:776/857 of 5iedA
- binding castanospermine: W314 (≠ F182), D342 (= D210), I343 (= I211), W416 (= W284), W453 (= W318), D455 (= D320), R515 (= R384), W528 (= W397), D531 (= D400), F564 (= F433), H589 (= H458)
5h9oA Complex of murine endoplasmic reticulum alpha-glucosidase ii with d- glucose (see paper)
34% identity, 90% coverage: 15:629/683 of query aligns to 139:776/857 of 5h9oA
5hjrA Murine endoplasmic reticulum alpha-glucosidase ii with bound covalent intermediate (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 179:774/855 of 5hjrA
5hjoA Murine endoplasmic reticulum alpha-glucosidase ii with bound substrate analogue (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 178:773/854 of 5hjoA
- binding D-glucal: D213 (= D86), F215 (≠ G88), W413 (= W284), M453 (≠ V321), D528 (= D400)
- binding 2-deoxy-alpha-D-arabino-hexopyranose: W311 (≠ F182), D339 (= D210), I340 (= I211), W450 (= W318), D452 (= D320), R512 (= R384), D528 (= D400), F561 (= F433), H586 (= H458)
7k9qA Co-crystal structure of alpha glucosidase with compound 4 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 176:772/853 of 7k9qA
- binding (1S,2S,3R,4S,5S)-5-amino-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: W310 (≠ F182), D338 (= D210), I339 (= I211), W449 (= W318), D451 (= D320), M452 (≠ V321), R511 (= R384), D527 (= D400), F560 (= F433), H585 (= H458)
7k9nA Co-crystal structure of alpha glucosidase with compound 2 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 176:772/853 of 7k9nA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(9-methoxynonyl)amino]cyclohexane-1,2,3,4-tetrol: W310 (≠ F182), D338 (= D210), I339 (= I211), W412 (= W284), W449 (= W318), D451 (= D320), R511 (= R384), D527 (= D400), F560 (= F433), H585 (= H458), D589 (≠ G462)
7kryA Co-crystal structure of alpha glucosidase with compound 11 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 177:773/854 of 7kryA
- binding (1S,2S,3R,4S,5S)-5-({6-[(4-azido-2-nitrophenyl)amino]hexyl}amino)-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: F214 (≠ G88), W311 (≠ F182), D339 (= D210), I340 (= I211), W411 (≠ D282), C412 (≠ A283), W413 (= W284), W450 (= W318), D452 (= D320), F459 (≠ N327), D528 (= D400), F561 (= F433), H586 (= H458)
7kb8A Co-crystal structure of alpha glucosidase with compound 8 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 177:773/854 of 7kb8A
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(4-{[2-nitro-4-(triazan-1-yl)phenyl]amino}butyl)amino]cyclohexane-1,2,3,4-tetrol: F214 (≠ G88), W311 (≠ F182), D339 (= D210), I340 (= I211), W413 (= W284), W450 (= W318), D452 (= D320), F459 (≠ N327), R512 (= R384), D528 (= D400), F561 (= F433), H586 (= H458)
7kadA Co-crystal structure of alpha glucosidase with compound 6 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 177:773/854 of 7kadA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(1H-1,2,3-triazol-1-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: F214 (≠ G88), W311 (≠ F182), D339 (= D210), I340 (= I211), W413 (= W284), W450 (= W318), D452 (= D320), F459 (≠ N327), D528 (= D400), F561 (= F433), H586 (= H458)
7k9oA Co-crystal structure of alpha glucosidase with compound 3 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 177:773/854 of 7k9oA
- binding (1~{S},2~{S},3~{R},4~{S},5~{S})-1-(hydroxymethyl)-5-[6-[[2-[oxidanyl(oxidanylidene)-$l^{4}-azanyl]-4-(1,2,3,4-tetrazol-1-yl)phenyl]amino]hexylamino]cyclohexane-1,2,3,4-tetrol: F214 (≠ G88), W311 (≠ F182), D339 (= D210), I340 (= I211), W413 (= W284), W450 (= W318), D452 (= D320), M453 (≠ V321), F459 (≠ N327), R512 (= R384), D528 (= D400), F561 (= F433), H586 (= H458)
7jtyA Co-crystal structure of alpha glucosidase with compound 1 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 174:770/851 of 7jtyA
- binding (1S,2S,3R,4S,5S)-5-(butylamino)-1-(hydroxymethyl)cyclohexane-1,2,3,4-tetrol: W308 (≠ F182), D336 (= D210), I337 (= I211), W410 (= W284), W447 (= W318), D449 (= D320), M450 (≠ V321), R509 (= R384), D525 (= D400), F558 (= F433), H583 (= H458)
7kb6A Co-crystal structure of alpha glucosidase with compound 7 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 173:769/850 of 7kb6A
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-[(6-{[2-nitro-4-(pyrimidin-2-yl)phenyl]amino}hexyl)amino]cyclohexane-1,2,3,4-tetrol: F210 (≠ G88), W307 (≠ F182), D335 (= D210), I336 (= I211), W409 (= W284), W446 (= W318), D448 (= D320), F455 (≠ N327), R508 (= R384), D524 (= D400), F557 (= F433), H582 (= H458)
7k9tA Co-crystal structure of alpha glucosidase with compound 5 (see paper)
35% identity, 84% coverage: 55:629/683 of query aligns to 173:769/850 of 7k9tA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-{[(5Z)-6-{[2-nitro-4-(2H-1,2,3-triazol-2-yl)phenyl]amino}hex-5-en-1-yl]amino}cyclohexane-1,2,3,4-tetrol: F210 (≠ G88), W307 (≠ F182), D335 (= D210), I336 (= I211), W409 (= W284), W446 (= W318), D448 (= D320), R508 (= R384), D524 (= D400), F557 (= F433), H582 (= H458)
Q8BHN3 Neutral alpha-glucosidase AB; Alpha-glucosidase 2; Glucosidase II subunit alpha; EC 3.2.1.207 from Mus musculus (Mouse) (see 3 papers)
34% identity, 84% coverage: 55:629/683 of query aligns to 248:863/944 of Q8BHN3
- D542 (= D320) active site, Nucleophile; mutation D->E,N: Loss of enzyme activity.
- D618 (= D400) active site, Proton donor; mutation to N: Loss of enzyme activity.
- C633 (≠ S415) modified: Disulfide link with 644
- C644 (≠ S426) modified: Disulfide link with 633
- R818 (≠ N585) mutation to E: Disrupts interaction with PRKCSH. Nearly abolishes enzyme activity.
Sites not aligning to the query:
- 1:32 signal peptide
- 41 modified: Disulfide link with 47
- 47 modified: Disulfide link with 41
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
5iegA Murine endoplasmic reticulum alpha-glucosidase ii with n-9'- methoxynonyl-1-deoxynojirimycin (see paper)
34% identity, 90% coverage: 15:629/683 of query aligns to 139:773/856 of 5iegA
- binding N-9'-methoxynonyl-1-deoxynojirimycin: F217 (≠ G88), W314 (≠ F182), D342 (= D210), I343 (= I211), W450 (= W318), D452 (= D320), R512 (= R384), W525 (= W397), D528 (= D400), F561 (= F433), H586 (= H458)
7kbrA Co-crystal structure of alpha glucosidase with compound 10 (see paper)
37% identity, 73% coverage: 134:629/683 of query aligns to 6:516/597 of 7kbrA
- binding 2-{[2-nitro-4-(triazan-1-yl)phenyl]amino}ethyl (2-{[(1S,2S,3R,4S,5S)-2,3,4,5-tetrahydroxy-5-(hydroxymethyl)cyclohexyl]amino}ethyl)carbamate: W54 (≠ F182), D82 (= D210), I83 (= I211), P96 (= P224), T97 (≠ K225), P100 (= P228), W154 (≠ D282), C155 (≠ A283), W156 (= W284), W193 (= W318), D195 (= D320), M196 (≠ V321), F202 (≠ N327), R255 (= R384), D271 (= D400), F304 (= F433), H329 (= H458), H331 (≠ C460)
7kbjA Co-crystal structure of alpha glucosidase with compound 9 (see paper)
37% identity, 73% coverage: 134:629/683 of query aligns to 6:516/597 of 7kbjA
- binding (1S,2S,3R,4S,5S)-1-(hydroxymethyl)-5-{[2-(2-{[2-nitro-4-(triazan-1-yl)phenyl]amino}ethoxy)ethyl]amino}cyclohexane-1,2,3,4-tetrol: W54 (≠ F182), D82 (= D210), I83 (= I211), W156 (= W284), W193 (= W318), D195 (= D320), F202 (≠ N327), R255 (= R384), D271 (= D400), F304 (= F433), H329 (= H458)
Query Sequence
>352826 FitnessBrowser__Btheta:352826
MVGDGIAKFIPEGFDAQKIPSFAIEKEPREQGALPADWVLVPEFSLTDGKANASLTVPEG
TSIYGGGEVTGSLLRNGKTIKLWNTDSGAYGVDKGTRLYQSHPWMMGVRKDGTAFGILFD
TTWKAELSSTDEKIELKSEGIPFRVFIIDRESPQAVIRGLSELTGTMPMIPRWALGYQQC
RFSYSPDSRVIEIADTFRLKRIPCDVIWMDIDYMDGYRIFTFNPKSFPNPKAVNRDLHIR
GFHSAWMIDPGAKVDPNYFVYKSGTENDVWVKTADGKNFHGDAWPGAAAFPDFTSPKVNK
WWRNLYKDFLAQGVDGVWNDVNEPQINDTPNKTMPEDNLHRGGGKLPAGTHLQYHNVYGF
LMVKASREGILDARPEKRPFILTRSNFLGGQRYAATWTGDNGSCWDHLKMSVPMSLTLGL
SGQPFSGADIGGFLFNADADLFGNWIGFGAFYPFARGHACAGTNNKEPWVFGQKVEDASR
IALERRYILLPYFYTLLHEASTNGMPIMRPVFFSDPKDLSLRAEEEAFLVGDNLLIIPAF
ANQPALPKGIWKELSLVEGDQNDKYQAKMKIRGGAIIPTGKIIQNTTENSLDPLTLLVCL
DEQGKASGNMYWDAGDGWSYKKGDYSLLQFVAERNGDKVTVKLTKKTGKYNTENKDMAVI
KIITDQGIRQASGNLVEGIEIRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory