Comparing 352834 FitnessBrowser__Btheta:352834 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3sbxA Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp (see paper)
31% identity, 85% coverage: 19:155/161 of query aligns to 34:170/177 of 3sbxA
7w2iA Crystal structure of log (rv1205) from mycobacterium tuberculosis (see paper)
33% identity, 85% coverage: 6:142/161 of query aligns to 26:162/183 of 7w2iA
O05306 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; Protein LONELY GUY homolog; LOG homolog; EC 3.2.2.n1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 85% coverage: 6:142/161 of query aligns to 30:166/187 of O05306
P48636 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; AMP nucleosidase; PaLOG; EC 3.2.2.n1; EC 3.2.2.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 87% coverage: 1:140/161 of query aligns to 19:158/195 of P48636
Q5ZC82 Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG; Protein LONELY GUY; EC 3.2.2.n1 from Oryza sativa subsp. japonica (Rice) (see paper)
33% identity, 99% coverage: 2:161/161 of query aligns to 52:211/242 of Q5ZC82
5zbkA Crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp (see paper)
36% identity, 87% coverage: 1:140/161 of query aligns to 18:157/182 of 5zbkA
Sites not aligning to the query:
5zblD Crystal structure of type-i log from corynebacterium glutamicum in complex with amp (see paper)
35% identity, 89% coverage: 1:143/161 of query aligns to 18:159/181 of 5zblD
Sites not aligning to the query:
5ajuA Crystal structure of ligand-free phosphoribohydroxylase lonely guy from claviceps purpurea in complex with phosphoribose (see paper)
29% identity, 95% coverage: 2:154/161 of query aligns to 19:194/217 of 5ajuA
Sites not aligning to the query:
6y01DDD p450 cytochrome, putative (see paper)
30% identity, 80% coverage: 3:130/161 of query aligns to 21:140/166 of 6y01DDD
>352834 FitnessBrowser__Btheta:352834
MYFDSARQIGEWMGKAGKTLIYGGANLGLMECVARAVKENGGTVIGVVPAKLEEKGSVST
LLDEVIHTRNLSDRKDVITEKSEILVALPGGVGTLDEIFHVIAAASIGYHQKKVIFYNEY
GFYNELLAALKTLEDKGFARQSFSTYYETANNLDELKEKIN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory