Comparing 352841 FitnessBrowser__Btheta:352841 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
33% identity, 94% coverage: 43:763/764 of query aligns to 4:645/674 of 5wabA
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
34% identity, 94% coverage: 38:756/764 of query aligns to 1:700/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
34% identity, 94% coverage: 38:756/764 of query aligns to 1:700/715 of 2x42A
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
30% identity, 95% coverage: 28:756/764 of query aligns to 3:734/765 of 7zb3A
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
31% identity, 95% coverage: 28:756/764 of query aligns to 3:723/753 of 7zgzX
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
30% identity, 95% coverage: 28:756/764 of query aligns to 3:734/763 of 7zdyW
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
30% identity, 95% coverage: 28:756/764 of query aligns to 3:743/772 of 8c7fA
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
32% identity, 90% coverage: 69:756/764 of query aligns to 73:728/742 of 3u48B
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
31% identity, 95% coverage: 31:756/764 of query aligns to 31:727/733 of 5tf0A
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
31% identity, 90% coverage: 67:756/764 of query aligns to 46:705/713 of 6jxgA
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
32% identity, 92% coverage: 51:756/764 of query aligns to 62:740/749 of 5xxmA
Sites not aligning to the query:
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
30% identity, 88% coverage: 86:756/764 of query aligns to 95:749/756 of 5z87A
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
32% identity, 92% coverage: 51:756/764 of query aligns to 51:729/744 of 5xxnA
Sites not aligning to the query:
5yqsA Isoprimeverose-producing enzyme from aspergillus oryzae in complex with isoprimeverose (see paper)
31% identity, 97% coverage: 27:764/764 of query aligns to 2:754/754 of 5yqsA
7eapA Crystal structure of ipea-xxxg complex (see paper)
30% identity, 97% coverage: 25:764/764 of query aligns to 1:755/755 of 7eapA
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
28% identity, 94% coverage: 38:756/764 of query aligns to 15:706/714 of 4i8dB
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
28% identity, 94% coverage: 38:756/764 of query aligns to 12:703/711 of 4i8dA
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
32% identity, 90% coverage: 69:752/764 of query aligns to 69:722/733 of 6r5nA
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
32% identity, 90% coverage: 69:752/764 of query aligns to 69:722/733 of 6r5iA
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
32% identity, 90% coverage: 69:752/764 of query aligns to 69:719/730 of 6r5vA
>352841 FitnessBrowser__Btheta:352841
MNMKFKATLLGLSIAAVLPTMNMAQTPVYLDTSKPIEERVKDALSRMTLEEKVKMTHAQS
KFSSPGVPRLGIPEVWATDGPHGIRPEVLWDEWDQAGWTNDSCIAYPALTCLSATWNPEM
SYLYGKSIGEEARYRKKDILLGPGVNIYRTPLNGRNFEYMGEDPYLSSMMVVPYIKGVQE
NGVAACVKHYALNNQEFNRHTTNVHLSDRALYEIYLPAFKAAVQEGGAWAIMGAYNLYSF
SEDTDSGKLYKTQHACHNKRLLQDILRKEWGFDGVVVSDWGGVHDTFQAISNGLDMEFGS
WTNGLSAGTRNAYDNYYLAHPYLKLIQDGTVGTKELDEKVSNILRLIFRTSMNPHKPFGS
LASPEHGQAGRKIGEEGIVLLQNKDNVLPIDLKKARKIAVIGENAIKMMTVGGGSSSLKV
KYEISPLDGLKNRVGSQAEVLYVRGYVGDPTGEYNGVQTGQDLKDDRSEDELLAEAVEVS
KDADYVIFFGGLNKSNHQDCEDSDRASLGLPYAQDRVIGELAKVNKNLIVVNISGNAVAM
PWVNEVPAIVQGWFLGSEAGTALASVLLGDANPSGKLPFTFPARLEDVGAHKLGEYPGNK
EELAHSKNNGDTINEIYREDIFVGYRWADKEKIKPLFPFGHGLSYTTFAYGKPSADKKVM
TADDTISFTINVKNTGTREGQEVIQLYVSDKKSSLPRPVKELKGFKKVKLAPGEEKAVTL
TIDKKALSFFDDVKHEWMTEPGKFEAVIGTSSRDIKGIVPFELR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory