SitesBLAST
Comparing 352847 FitnessBrowser__Btheta:352847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 93% coverage: 1:235/254 of query aligns to 1:197/216 of Q9X1K8
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
31% identity, 93% coverage: 1:235/254 of query aligns to 6:202/218 of 1vm6B
- active site: H132 (= H136), K136 (= K140)
- binding nicotinamide-adenine-dinucleotide: G12 (= G7), S14 (vs. gap), G15 (= G9), R16 (≠ K10), M17 (= M11), D37 (= D31), V38 (= V32), F53 (= F52), S54 (≠ T53), S55 (≠ N54), E57 (vs. gap), A58 (vs. gap), G76 (= G75), T78 (= T77), Y101 (≠ S102), N102 (= N103), F103 (= F104), F192 (= F225)
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
33% identity, 80% coverage: 47:249/254 of query aligns to 71:265/268 of 4ywjA
- active site: H156 (= H136), K160 (= K140)
- binding nicotinamide-adenine-dinucleotide: F76 (= F52), T77 (= T53), V81 (= V57), G99 (= G75), T101 (= T77), A124 (≠ S102), N125 (= N103), F126 (= F104), R237 (= R222), F240 (= F225)
Sites not aligning to the query:
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
32% identity, 80% coverage: 47:249/254 of query aligns to 70:264/269 of 5tejB
- active site: H155 (= H136), K159 (= K140)
- binding 2,5 Furan Dicarboxylic Acid: T100 (= T77), H156 (= H137), K159 (= K140), S164 (= S145), G165 (= G146), T166 (= T147)
- binding nicotinamide-adenine-dinucleotide: F75 (= F52), T76 (= T53), S80 (≠ V57), G98 (= G75), T100 (= T77), P123 (≠ S102), N124 (= N103), Y125 (≠ F104), F239 (= F225)
Sites not aligning to the query:
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
32% identity, 80% coverage: 47:249/254 of query aligns to 70:264/269 of 5tejA
Sites not aligning to the query:
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
32% identity, 80% coverage: 47:249/254 of query aligns to 70:264/266 of 5temA
- active site: H155 (= H136), K159 (= K140)
- binding nicotinamide-adenine-dinucleotide: F75 (= F52), T76 (= T53), S80 (≠ V57), G98 (= G75), T100 (= T77), P123 (≠ S102), N124 (= N103), Y125 (≠ F104), F239 (= F225)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T77), P123 (≠ S102), H156 (= H137), K159 (= K140), S164 (= S145), G165 (= G146), T166 (= T147)
Sites not aligning to the query:
P9WP23 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 98% coverage: 1:249/254 of query aligns to 1:242/245 of P9WP23
- K9 (vs. gap) mutation to A: Increases the nucleotide specificity from 6:1 for the wild-type enzyme to 34:1, due to a 4-fold decrease in NADPH affinity while the affinity for NADH remains nearly unchanged.
- K11 (= K10) mutation to A: 2.8-fold increase in catalytic activity with NADH as substrate, while the affinity for NADH is essentially unaffected. 70-fold decrease in affinity for NADPH, causing the nucleotide specificity to increase from 6:1 for the wild-type enzyme to 187:1.
- KV 11:12 (≠ KM 10:11) binding ; binding
- D33 (= D33) binding
- GTT 75:77 (≠ GST 75:77) binding ; binding
- APNF 102:105 (≠ SSNF 101:104) binding ; binding
- K136 (= K140) binding ; binding
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
25% identity, 98% coverage: 1:249/254 of query aligns to 1:242/245 of 1p9lA
- active site: H132 (= H136), K136 (= K140)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G7 (= G7), G10 (= G9), K11 (= K10), V12 (≠ M11), D33 (= D33), A34 (≠ N34), F52 (= F52), T53 (= T53), V57 (= V57), G75 (= G75), T77 (= T77), P103 (≠ S102), N104 (= N103), F105 (= F104), F217 (= F225)
- binding pyridine-2,6-dicarboxylic acid: H133 (= H137), K136 (= K140), S141 (= S145), G142 (= G146), T143 (= T147), A192 (≠ G200)
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
25% identity, 98% coverage: 1:249/254 of query aligns to 1:242/245 of 1c3vA
- active site: H132 (= H136), K136 (= K140)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K9 (vs. gap), G10 (= G9), K11 (= K10), V12 (≠ M11), D33 (= D33), A34 (≠ N34), F52 (= F52), T53 (= T53), V57 (= V57), G75 (= G75), T77 (= T77), P103 (≠ S102), N104 (= N103), F217 (= F225)
- binding pyridine-2,6-dicarboxylic acid: T77 (= T77), N104 (= N103), K136 (= K140), S141 (= S145), G142 (= G146), T143 (= T147), A192 (≠ G200)
5ugvA Dapb from mycobacterium tuberculosis (see paper)
25% identity, 98% coverage: 1:249/254 of query aligns to 2:243/245 of 5ugvA
5tjzA Structure of 4-hydroxytetrahydrodipicolinate reductase from mycobacterium tuberculosis with NADPH and 2,6 pyridine dicarboxylic acid (see paper)
25% identity, 98% coverage: 1:249/254 of query aligns to 2:243/245 of 5tjzA
- active site: H133 (= H136), K137 (= K140)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G11 (= G9), K12 (= K10), V13 (≠ M11), D34 (= D33), A35 (≠ N34), F53 (= F52), T54 (= T53), G76 (= G75), T77 (≠ S76), T78 (= T77), P104 (≠ S102), N105 (= N103), F106 (= F104), F218 (= F225)
- binding pyridine-2,6-dicarboxylic acid: T78 (= T77), P104 (≠ S102), H134 (= H137), K137 (= K140), S142 (= S145), G143 (= G146), T144 (= T147), A193 (≠ G200)
1drwA Escherichia coli dhpr/nhdh complex (see paper)
28% identity, 100% coverage: 1:253/254 of query aligns to 5:271/272 of 1drwA
- active site: H158 (= H136), K162 (= K140)
- binding nicotinamide purin-6-ol-dinucleotide: G11 (= G7), G14 (vs. gap), R15 (≠ K10), M16 (= M11), E37 (≠ D31), R38 (≠ V32), F78 (= F52), T79 (= T53), R80 (≠ N54), G101 (= G75), T102 (≠ S76), T103 (= T77), A126 (≠ S102), N127 (= N103), F128 (= F104), F242 (= F225)
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
28% identity, 100% coverage: 1:253/254 of query aligns to 5:271/272 of 1dihA
- active site: H158 (= H136), K162 (= K140)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G7), G14 (vs. gap), R15 (≠ K10), M16 (= M11), R38 (≠ V32), F78 (= F52), T79 (= T53), R80 (≠ N54), G83 (≠ V57), G101 (= G75), T103 (= T77), N127 (= N103), F128 (= F104), R239 (= R222), F242 (= F225)
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
26% identity, 100% coverage: 1:253/254 of query aligns to 2:268/269 of 1arzB
- active site: H155 (= H136), K159 (= K140)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G7), G10 (= G9), G11 (vs. gap), R12 (≠ K10), M13 (= M11), E34 (≠ D31), F75 (= F52), T76 (= T53), R77 (≠ N54), G80 (≠ V57), H84 (≠ N61), G98 (= G75), T100 (= T77), A123 (≠ S102), N124 (= N103), F125 (= F104), F239 (= F225)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T77), H156 (= H137), K159 (= K140), S164 (= S145), G165 (= G146), T166 (= T147), F239 (= F225)
1drvA Escherichia coli dhpr/acnadh complex (see paper)
26% identity, 100% coverage: 1:253/254 of query aligns to 3:269/270 of 1drvA
- active site: H156 (= H136), K160 (= K140)
- binding 3-acetylpyridine adenine dinucleotide: G9 (= G7), G12 (vs. gap), R13 (≠ K10), M14 (= M11), E35 (≠ D31), F76 (= F52), T77 (= T53), R78 (≠ N54), G81 (≠ V57), G99 (= G75), A124 (≠ S102), F126 (= F104), R237 (= R222)
1druA Escherichia coli dhpr/nadh complex (see paper)
26% identity, 100% coverage: 1:253/254 of query aligns to 3:269/270 of 1druA
- active site: H156 (= H136), K160 (= K140)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (vs. gap), R13 (≠ K10), M14 (= M11), E35 (≠ D31), R36 (≠ V32), F76 (= F52), T77 (= T53), R78 (≠ N54), G81 (≠ V57), G99 (= G75), T100 (≠ S76), T101 (= T77), A124 (≠ S102), N125 (= N103), F126 (= F104), F240 (= F225)
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
26% identity, 100% coverage: 1:253/254 of query aligns to 3:269/270 of 1arzA
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 100% coverage: 1:253/254 of query aligns to 6:272/273 of P04036
- G12 (= G7) binding
- GRM 15:17 (≠ -KM 10:11) binding
- RM 16:17 (≠ KM 10:11) binding
- E38 (≠ D31) binding
- R39 (≠ V32) binding
- TR 80:81 (≠ TN 53:54) binding
- GTT 102:104 (≠ GST 75:77) binding ; binding
- AANF 126:129 (≠ SSNF 101:104) binding
- F129 (= F104) binding
- H159 (= H136) mutation H->A,Q: 135 to 200-fold reduction in catalytic activity.
- K163 (= K140) binding ; mutation K->A,C,Q: 625 to 830-fold reduction in catalytic activity.
- R240 (= R222) binding
- F243 (= F225) binding
1yl5A Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) (see paper)
25% identity, 98% coverage: 2:249/254 of query aligns to 4:244/247 of 1yl5A
3ijpB Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
28% identity, 98% coverage: 1:249/254 of query aligns to 2:264/267 of 3ijpB
Query Sequence
>352847 FitnessBrowser__Btheta:352847
MKIALIGYGKMGKELEKAALSRGHEIVCIIDVDNQEDFESEAFKSADVAIEFTNPMVAYS
NYMKAFKAGVKLVSGSTGWMAEHGEEIKKLCTEGGKTLFWSSNFSLGVAIFSSVNKYLAK
IMNQFPGYDVTMSETHHIHKLDAPSGTAITLAEGILENMDRKDKWVKGTLLAPDGTVSGT
DACASNEFPIDSIREGEVFGIHTIRYESEVDSISITHDAKNRGGFVLGAILAAEYTAQHE
GYLGMSDLFPFLNE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory