SitesBLAST
Comparing 352883 FitnessBrowser__Btheta:352883 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
43% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of 1mtoA
- active site: G11 (= G10), R72 (= R72), C73 (≠ E73), D103 (≠ N109), G104 (= G110), G124 (≠ K130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (≠ H177)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D133), R162 (= R168), M169 (= M175), R171 (≠ H177), E222 (= E228), R243 (= R255), H249 (≠ Y261), R252 (= R264)
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
41% identity, 90% coverage: 2:303/336 of query aligns to 4:292/320 of 1pfkA
- active site: G12 (= G10), R73 (= R72), F74 (≠ E73), D104 (≠ N109), G105 (= G110), G125 (≠ K130), T126 (= T131), D128 (= D133), D130 (= D135), R172 (≠ H177)
- binding adenosine-5'-diphosphate: G11 (= G9), R22 (= R20), R26 (≠ K24), Y56 (≠ K55), S59 (= S58), D60 (≠ G59), R73 (= R72), F74 (≠ E73), F77 (= F76), R78 (≠ K77), G103 (= G108), D104 (≠ N109), G105 (= G110), S106 (≠ T111), M108 (≠ K113), G109 (≠ T114), R155 (≠ H160), G213 (= G218), K214 (= K219), H216 (≠ Y221)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G10), R73 (= R72), T126 (= T131), D128 (= D133), M170 (= M175), E223 (= E228), H250 (≠ Y261), R253 (= R264)
- binding magnesium ion: G186 (= G191), E188 (≠ D193)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 90% coverage: 2:303/336 of query aligns to 4:292/320 of P0A796
- G12 (= G10) binding
- RGVVR 22:26 (≠ RGVCK 20:24) binding
- RYSVSD 55:60 (≠ DKSLSG 54:59) binding
- RF 73:74 (≠ RE 72:73) binding
- GDGS 103:106 (≠ GNGT 108:111) binding
- D104 (≠ N109) binding
- TID 126:128 (= TID 131:133) binding in other chain
- D128 (= D133) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (≠ H160) binding in other chain
- R163 (= R168) binding
- R172 (≠ H177) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GGD 191:193) binding in other chain
- KKH 214:216 (≠ KPY 219:221) binding in other chain
- E223 (= E228) binding in other chain
- R244 (= R255) binding
- HIQR 250:253 (≠ YIQR 261:264) binding in other chain
6pfkA Phosphofructokinase, inhibited t-state (see paper)
42% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of 6pfkA
- active site: G11 (= G10), R72 (= R72), C73 (≠ E73), D103 (≠ N109), G104 (= G110), G124 (≠ K130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (≠ H177)
- binding 2-phosphoglycolic acid: R21 (= R20), R25 (≠ K24), G58 (≠ S58), D59 (≠ G59), R154 (≠ H160), R211 (≠ K217), K213 (= K219)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
42% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of P00512
- RSVVR 21:25 (≠ RGVCK 20:24) binding
- D59 (≠ G59) binding
- RC 72:73 (≠ RE 72:73) binding
- D103 (≠ N109) binding
- TID 125:127 (= TID 131:133) binding in other chain
- R154 (≠ H160) binding in other chain
- R162 (= R168) binding
- MGR 169:171 (≠ MGH 175:177) binding in other chain
- GAE 185:187 (≠ GGD 191:193) binding in other chain
- R211 (≠ K217) binding in other chain
- KKH 213:215 (≠ KPY 219:221) binding in other chain
- E222 (= E228) binding in other chain
- R243 (= R255) binding
- HVQR 249:252 (≠ YIQR 261:264) binding in other chain
4pfkA Phosphofructokinase. Structure and control (see paper)
42% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of 4pfkA
- active site: G11 (= G10), R72 (= R72), C73 (≠ E73), D103 (≠ N109), G104 (= G110), G124 (≠ K130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (≠ H177)
- binding adenosine-5'-diphosphate: S9 (= S8), Y41 (≠ F41), R72 (= R72), C73 (≠ E73), F76 (= F76), K77 (= K77), G104 (= G110), G108 (≠ T114), R154 (≠ H160), G185 (= G191), R211 (≠ K217), G212 (= G218), K213 (= K219), H215 (≠ Y221)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D133), M169 (= M175), E222 (= E228), H249 (≠ Y261), R252 (= R264)
- binding magnesium ion: G185 (= G191), E187 (≠ D193)
3pfkA Phosphofructokinase. Structure and control (see paper)
42% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of 3pfkA
- active site: G11 (= G10), R72 (= R72), C73 (≠ E73), D103 (≠ N109), G104 (= G110), G124 (≠ K130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (≠ H177)
- binding phosphate ion: R154 (≠ H160), K213 (= K219), H249 (≠ Y261), R252 (= R264)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
42% identity, 92% coverage: 2:310/336 of query aligns to 3:298/319 of 4i4iA
- active site: G11 (= G10), R72 (= R72), C73 (≠ E73), D103 (≠ N109), G104 (= G110), G124 (≠ K130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (≠ H177)
- binding phosphoenolpyruvate: R21 (= R20), R25 (≠ K24), G58 (≠ S58), R154 (≠ H160), R211 (≠ K217), K213 (= K219), H215 (≠ Y221)
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
38% identity, 93% coverage: 2:315/336 of query aligns to 3:305/322 of 5xz7A
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
38% identity, 93% coverage: 2:315/336 of query aligns to 3:305/318 of 5xz6A
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
39% identity, 92% coverage: 2:311/336 of query aligns to 3:301/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
39% identity, 92% coverage: 2:311/336 of query aligns to 3:301/322 of Q2FXM8
- RC 72:73 (≠ RE 72:73) binding
- GDGS 102:105 (≠ GNGT 108:111) binding
- TID 127:129 (= TID 131:133) binding in other chain
- G150 (≠ D154) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A155) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R168) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (≠ MGH 175:177) binding in other chain
- E224 (= E228) binding in other chain
- R245 (= R255) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ YIQR 261:264) binding in other chain
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
39% identity, 92% coverage: 2:311/336 of query aligns to 3:301/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S8), Y41 (≠ F41), C73 (≠ E73), F76 (= F76), K77 (= K77), G102 (= G108), D103 (≠ N109), G104 (= G110), S105 (≠ T111), R107 (≠ K113), G108 (≠ T114)
3o8lA Structure of phosphofructokinase from rabbit skeletal muscle (see paper)
33% identity, 96% coverage: 3:323/336 of query aligns to 10:355/748 of 3o8lA
- active site: G17 (= G10), R80 (= R72), D111 (≠ N109), S156 (≠ T131), D158 (= D133), D160 (= D135), R202 (≠ H177)
- binding adenosine-5'-diphosphate: D165 (= D140), M166 (≠ I141), F300 (= F271)
- binding adenosine-5'-triphosphate: G16 (= G9), Y47 (≠ F41), R80 (= R72), C81 (≠ E73), R85 (≠ K77), G110 (= G108), G112 (= G110), S113 (≠ T111), T115 (≠ K113), G116 (≠ T114), W219 (≠ V194), H234 (≠ T210), R238 (= R214)
Sites not aligning to the query:
P00511 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
33% identity, 96% coverage: 3:323/336 of query aligns to 18:363/780 of P00511
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 775 modified: Phosphoserine; by PKA
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
32% identity, 97% coverage: 3:329/336 of query aligns to 18:376/780 of P08237
- R39 (≠ K24) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G43) to V: in GSD7; Italian
- R100 (≠ L90) to Q: in dbSNP:rs2228500
- S180 (= S147) to C: in GSD7; Italian
- G209 (= G176) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D272) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
32% identity, 96% coverage: 3:323/336 of query aligns to 18:363/780 of P17858
- G81 (= G65) natural variant: G -> A
- R151 (≠ A116) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
32% identity, 96% coverage: 3:323/336 of query aligns to 8:353/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (= R72), C79 (≠ E73), T83 (≠ S83), G108 (= G108), G110 (= G110), S111 (≠ T111), G114 (vs. gap), I117 (vs. gap)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I132), D156 (= D133), R191 (= R168), M198 (= M175), R200 (≠ H177), E254 (= E228), R282 (= R255), H288 (≠ Y261), R291 (= R264)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ I141), F298 (= F271), I301 (≠ N274), K305 (≠ R278), N331 (≠ D301)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
Q92448 ATP-dependent 6-phosphofructokinase subunit alpha; ATP-dependent 6-phosphofructokinase 1; ATP-PFK 1; Phosphofructokinase 1; Glucose-induced selective autophagy 1 protein; Phosphohexokinase 1; EC 2.7.1.11 from Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) (see paper)
32% identity, 95% coverage: 2:320/336 of query aligns to 212:555/989 of Q92448
- D361 (= D133) mutation to S: Abolishes catalytic activity, but not the ability to modulate glucose-induced microautophagy of peroxisomes.
Q8TGA0 ATP-dependent 6-phosphofructokinase subunit beta; ATP-dependent 6-phosphofructokinase 2; ATP-PFK 2; Phosphofructokinase 2; Phosphohexokinase 2; EC 2.7.1.11 from Komagataella pastoris (Yeast) (Pichia pastoris) (see 2 papers)
32% identity, 91% coverage: 3:308/336 of query aligns to 184:516/941 of Q8TGA0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 557:558 binding
Query Sequence
>352883 FitnessBrowser__Btheta:352883
MRIGILTSGGDCPGINATIRGVCKTAINHYGMEVIGIHSGFQGLLTKDIESFTDKSLSGL
LNQGGTMLGTSREKPFKKGGVVSDVDKPALILQNIQEMGLDCVVCIGGNGTQKTAAKFAA
MGVNIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILVPEIPYNIKNIGNTILERLKKGKPYSIVVVAEGILTDGRKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIANGQFGRMIALKG
DDISSIPLEEVAGKLKLVTEDHDLVIQGRRMGICFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory