SitesBLAST
Comparing 352997 FitnessBrowser__Btheta:352997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
31% identity, 32% coverage: 29:173/460 of query aligns to 3:145/336 of 3ec7A
- active site: K97 (= K125)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), M12 (≠ N38), I13 (≠ R39), D35 (= D60), I36 (≠ V61), R40 (≠ H67), T73 (≠ A101), A74 (≠ T102), S75 (≠ P103), N76 (≠ D104), H79 (= H107), E96 (= E124), K97 (= K125), M126 (≠ Q154)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
29% identity, 29% coverage: 54:188/460 of query aligns to 32:161/363 of 7xreC
Sites not aligning to the query:
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
30% identity, 38% coverage: 19:191/460 of query aligns to 1:177/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K125), Y143 (≠ N153)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G35), G19 (≠ N38), S22 (≠ Q41), Q23 (= Q42), I24 (= I43), D46 (= D60), I47 (≠ V61), T91 (= T102), P92 (= P103), N93 (≠ D104), H96 (= H107), E113 (= E124), K114 (= K125)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 190, 204, 208
- binding 1,4-dihydronicotinamide adenine dinucleotide: 189, 190, 208, 332
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
30% identity, 38% coverage: 19:191/460 of query aligns to 2:178/389 of 7d5mA
- binding nicotinamide-adenine-dinucleotide: G18 (= G35), G20 (≠ N38), S23 (≠ Q41), Q24 (= Q42), I25 (= I43), D47 (= D60), I48 (≠ V61), T92 (= T102), P93 (= P103), N94 (≠ D104), H97 (= H107), E114 (= E124), K115 (= K125)
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
30% identity, 38% coverage: 19:191/460 of query aligns to 1:177/379 of 7d5nA
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G35), G19 (≠ N38), S22 (≠ Q41), Q23 (= Q42), I24 (= I43), D46 (= D60), I47 (≠ V61), T91 (= T102), P92 (= P103), N93 (≠ D104), H96 (= H107), E113 (= E124), K114 (= K125)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
31% identity, 27% coverage: 29:152/460 of query aligns to 4:123/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G35), G12 (= G37), A13 (≠ N38), Q14 (≠ R39), D36 (= D60), S37 (≠ V61), R41 (≠ G64), A73 (= A101), G74 (≠ T102), L78 (≠ S106), E96 (= E124), K97 (= K125)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
31% identity, 23% coverage: 83:188/460 of query aligns to 51:151/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K125), R150 (= R187)
- binding nicotinamide-adenine-dinucleotide: D51 (= D83), Y52 (≠ F84), C67 (≠ A101), T68 (= T102), P69 (= P103), H73 (= H107), E90 (= E124), K91 (= K125), P92 (= P126), Q119 (= Q154)
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
32% identity, 25% coverage: 79:191/460 of query aligns to 61:173/374 of 3dtyA
Sites not aligning to the query:
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
25% identity, 32% coverage: 28:176/460 of query aligns to 33:185/439 of 6t2bB
- binding nicotinamide-adenine-dinucleotide: G40 (= G35), G43 (≠ N38), R44 (= R39), D65 (= D60), L66 (≠ V61), D93 (= D83), S111 (≠ A101), T112 (= T102), W114 (≠ D104), H117 (= H107), E134 (= E124), V135 (≠ K125), N163 (≠ V151)
Sites not aligning to the query:
2ixaA A-zyme, n-acetylgalactosaminidase (see paper)
35% identity, 23% coverage: 27:134/460 of query aligns to 1:113/426 of 2ixaA
- binding nicotinamide-adenine-dinucleotide: A9 (≠ G35), G11 (= G37), L12 (≠ N38), R13 (= R39), D34 (= D60), P35 (≠ V61), M39 (vs. gap), N62 (vs. gap), S80 (≠ A101), S81 (≠ T102), P82 (= P103), W83 (≠ D104), W85 (≠ S106), H86 (= H107), H89 (≠ I110), E103 (= E124), V104 (≠ K125)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
29% identity, 34% coverage: 29:184/460 of query aligns to 3:157/339 of 4mjlD
- active site: K97 (= K125)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K125), H155 (= H182), N157 (= N184)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), A12 (≠ N38), M13 (≠ R39), D35 (= D60), I36 (≠ V61), V73 (≠ A101), S74 (≠ T102), H79 (= H107), E96 (= E124), K97 (= K125), M126 (≠ Q154)
Sites not aligning to the query:
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: 172, 173, 176, 236
- binding nicotinamide-adenine-dinucleotide: 172, 274, 282
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 34% coverage: 29:184/460 of query aligns to 3:157/339 of 4mioD
- active site: K97 (= K125)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K125), H155 (= H182), N157 (= N184)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ N38), M13 (≠ R39), D35 (= D60), I36 (≠ V61), S74 (≠ T102), A78 (≠ S106), H79 (= H107), E96 (= E124), K97 (= K125), M126 (≠ Q154)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 172, 173, 176, 236
- binding 1,4-dihydronicotinamide adenine dinucleotide: 172, 274, 282
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 34% coverage: 29:184/460 of query aligns to 3:157/339 of 4mioA
- active site: K97 (= K125)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G37), A12 (≠ N38), M13 (≠ R39), D35 (= D60), I36 (≠ V61), S74 (≠ T102), F75 (≠ P103), H79 (= H107), E96 (= E124), K97 (= K125)
Sites not aligning to the query:
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
29% identity, 34% coverage: 29:184/460 of query aligns to 3:157/339 of 4minA
- active site: K97 (= K125)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), A12 (≠ N38), M13 (≠ R39), D35 (= D60), I36 (≠ V61), V73 (≠ A101), S74 (≠ T102), F75 (≠ P103), H79 (= H107), E96 (= E124), K97 (= K125)
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
32% identity, 22% coverage: 81:182/460 of query aligns to 54:153/340 of 4n54A
- active site: K96 (= K125)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: K96 (= K125)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S73 (≠ T102), P74 (= P103), F77 (≠ S106), H78 (= H107), E95 (= E124), K96 (= K125), M125 (≠ Q154)
Sites not aligning to the query:
- active site: 183
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 12, 156, 179, 180, 183, 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 8, 9, 10, 11, 12, 13, 35, 36, 40, 167, 284
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
26% identity, 36% coverage: 26:190/460 of query aligns to 2:153/309 of Q53TZ2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 169 D→A: Loss of activity.
- 173 N→A: Decrease by 4 orders of magnitude in catalytic efficiency.
3e18A Crystal structure of NAD-binding protein from listeria innocua
26% identity, 49% coverage: 27:252/460 of query aligns to 2:181/348 of 3e18A
- active site: K94 (= K125), H178 (= H249)
- binding nicotinamide-adenine-dinucleotide: G12 (= G37), G13 (≠ N38), M14 (≠ R39), F34 (≠ C59), D35 (= D60), I36 (≠ V61), K40 (≠ A65), A70 (= A101), T71 (= T102), P72 (= P103), N73 (≠ D104), H76 (= H107), E93 (= E124), K94 (= K125), N122 (= N184), W161 (= W232), R162 (= R233), H178 (= H249)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
27% identity, 37% coverage: 27:195/460 of query aligns to 2:171/336 of 5a06A
- active site: K101 (= K125)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ I36), G12 (= G37), Y13 (≠ N38), Y14 (≠ R39), S36 (≠ M63), G37 (= G64), T38 (≠ A65), K41 (≠ T68), Y59 (≠ R85), I77 (≠ A101), T78 (= T102), P79 (= P103), N80 (≠ D104), L82 (≠ S106), H83 (= H107), E100 (= E124), K101 (= K125), R129 (≠ Q154), W168 (= W192), R169 (≠ D193)
- binding sorbitol: R2 (≠ E27), D72 (= D96), H96 (= H120), K101 (= K125), R122 (≠ L147), R122 (≠ L147), L124 (≠ T149), F160 (≠ N184), R169 (≠ D193)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 37% coverage: 27:195/460 of query aligns to 2:171/336 of 5a03C
- active site: K101 (= K125)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G35), L11 (≠ I36), G12 (= G37), Y13 (≠ N38), Y14 (≠ R39), S36 (≠ M63), G37 (= G64), T38 (≠ A65), K41 (≠ T68), Y59 (≠ R85), I77 (≠ A101), T78 (= T102), P79 (= P103), N80 (≠ D104), L82 (≠ S106), H83 (= H107), E100 (= E124), K101 (= K125), R129 (≠ Q154), W168 (= W192), R169 (≠ D193)
- binding beta-D-xylopyranose: K101 (= K125), F160 (≠ N184), R169 (≠ D193)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 37% coverage: 27:195/460 of query aligns to 1:170/335 of 5a05A
- active site: K100 (= K125)
- binding beta-D-glucopyranose: K100 (= K125), F159 (≠ N184)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G35), L10 (≠ I36), G11 (= G37), Y12 (≠ N38), Y13 (≠ R39), S35 (≠ M63), G36 (= G64), T37 (≠ A65), K40 (≠ T68), Y58 (≠ R85), I76 (≠ A101), T77 (= T102), P78 (= P103), N79 (≠ D104), L81 (≠ S106), H82 (= H107), E99 (= E124), K100 (= K125), R128 (≠ Q154), W167 (= W192), R168 (≠ D193)
Sites not aligning to the query:
Query Sequence
>352997 FitnessBrowser__Btheta:352997
MASAGLAAGAGEILNAQTLSSSKNKNEKVKIAYVGIGNRGQQIIEDFARTGMVEVVALCD
VDMGAKHTQKVIGMYPKAKQFRDFRQMFDKAGKEFDAVAIATPDHSHFPISMLALASGKH
VYVEKPLARTFYEAELLMQAALKRPNLATQVGNQGHSEANYFQFKAWMDAGIIKDVTAVT
AHMNNVRRWHKWDTNIYKLPSGQQLPKDMDWDTWLGAVPYHEYNEKYHQGEWRCWYDFGM
GALGDWGAHILDTVHEFLELGLPYEVTLLHEKGHNDYFFPYSSTILFRFPQRKGMPPVDI
TWYDGLDNLPPIPAGYGVSGLDPNIPTTNQGDVPAAKLNPGKIIYTKDLTFKGGSHGSTL
SIIPEEKAKEMADKLPQIPKSPSNHFENFLLACNGIEKTRSPFEINGVLSQVFSLGVMAQ
RLNTQLFFDSRTKQITNNEFANAMLTGIPPRKGWDEFYKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory