Comparing 353076 FitnessBrowser__Btheta:353076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
25% identity, 92% coverage: 13:340/355 of query aligns to 6:364/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 96% coverage: 11:350/355 of query aligns to 9:382/383 of 7uoiA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 81% coverage: 11:296/355 of query aligns to 4:301/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 81% coverage: 11:296/355 of query aligns to 4:301/376 of 4o23A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
24% identity, 68% coverage: 8:249/355 of query aligns to 1:258/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
24% identity, 68% coverage: 8:249/355 of query aligns to 5:262/380 of 5vo3A
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
30% identity, 52% coverage: 67:249/355 of query aligns to 74:275/407 of P37111
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
21% identity, 72% coverage: 8:263/355 of query aligns to 3:273/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
29% identity, 52% coverage: 67:249/355 of query aligns to 74:276/408 of Q03154
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
22% identity, 78% coverage: 66:343/355 of query aligns to 65:355/366 of Q8P8J5
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
25% identity, 44% coverage: 8:163/355 of query aligns to 3:167/258 of 4h2kA
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
22% identity, 78% coverage: 66:343/355 of query aligns to 66:350/360 of 2f7vA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
22% identity, 61% coverage: 52:267/355 of query aligns to 49:272/377 of 7t1qA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
31% identity, 43% coverage: 11:163/355 of query aligns to 2:145/341 of 5xoyA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
37% identity, 22% coverage: 69:147/355 of query aligns to 121:202/503 of Q8C165
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
35% identity, 25% coverage: 62:148/355 of query aligns to 92:181/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
35% identity, 25% coverage: 62:148/355 of query aligns to 92:181/478 of 2zofA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
35% identity, 25% coverage: 62:148/355 of query aligns to 88:177/475 of Q9D1A2
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
34% identity, 25% coverage: 62:148/355 of query aligns to 88:177/475 of Q96KP4
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
27% identity, 55% coverage: 68:264/355 of query aligns to 17:210/392 of 7m6uB
Sites not aligning to the query:
>353076 FitnessBrowser__Btheta:353076
MKYDIPTMTAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGMQTGRKGNNVWCLSPM
FDLKKPTILLNSHIDTVKPVNGWRKDPFTPREENGKLYGLGSNDAGASVVSLLQVFLQLC
RTSQNYNLIYLASCEEEVSGKEGIESVLPGLPPVSFAIVGEPTEMQPAIAEKGLMVLDVT
ATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKMSVTVINAGTQHNVVPD
KCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKHPFVQKAVKMGRIP
FGSPTLSDQALMSFASVKIGPGRSSRSHTAEEYIMLKEIEEAIGIYLDLLDGLKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory