Comparing 353094 FitnessBrowser__Btheta:353094 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
100% identity, 97% coverage: 25:771/771 of query aligns to 1:747/749 of 5xxmA
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
99% identity, 96% coverage: 28:771/771 of query aligns to 1:736/744 of 5xxnA
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
78% identity, 96% coverage: 27:770/771 of query aligns to 1:733/733 of 5tf0A
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
69% identity, 96% coverage: 29:768/771 of query aligns to 2:732/742 of 3u48B
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
49% identity, 96% coverage: 28:770/771 of query aligns to 2:729/730 of 6r5vA
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
49% identity, 96% coverage: 28:770/771 of query aligns to 2:729/730 of 6r5oA
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
49% identity, 96% coverage: 28:770/771 of query aligns to 2:732/733 of 6r5nA
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
49% identity, 96% coverage: 28:770/771 of query aligns to 2:732/733 of 6r5iA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
49% identity, 96% coverage: 28:770/771 of query aligns to 2:732/733 of 6r5tA
4zobA Crystal structure of beta-glucosidase from listeria innocua in complex with gluconolactone (see paper)
39% identity, 95% coverage: 33:763/771 of query aligns to 6:710/722 of 4zobA
4zoaA Crystal structure of beta-glucosidase from listeria innocua in complex with isofagomine (see paper)
39% identity, 95% coverage: 33:763/771 of query aligns to 6:704/716 of 4zoaA
4zo7A Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with gentiobiose (see paper)
39% identity, 95% coverage: 33:763/771 of query aligns to 6:712/724 of 4zo7A
4zo6B Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with cellobiose (see paper)
39% identity, 95% coverage: 33:763/771 of query aligns to 6:712/724 of 4zo6B
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
36% identity, 96% coverage: 27:764/771 of query aligns to 9:734/765 of 7zb3A
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
36% identity, 96% coverage: 27:764/771 of query aligns to 9:723/753 of 7zgzX
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
36% identity, 96% coverage: 27:764/771 of query aligns to 9:734/763 of 7zdyW
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
36% identity, 96% coverage: 27:764/771 of query aligns to 9:743/772 of 8c7fA
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
34% identity, 96% coverage: 30:770/771 of query aligns to 3:764/765 of 5z9sA
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
35% identity, 95% coverage: 40:770/771 of query aligns to 25:755/756 of 5z87A
5jp0A Bacteroides ovatus xyloglucan pul gh3b with bound glucose (see paper)
33% identity, 95% coverage: 29:763/771 of query aligns to 10:731/745 of 5jp0A
>353094 FitnessBrowser__Btheta:353094
MINKKIFFSLLLLAAGFLSAAAQKSPQDMDRFIDALMKKMTVEEKIGQLNLPVTGEITTG
QAKSSDIAAKIKRGEVGGLFNLKGVEKIRDVQKQAVEQSRLGIPLLFGMDVIHGYETMFP
IPLGLSCTWDMTAIEESARIAAIEASADGISWTFSPMVDISRDPRWGRVSEGSGEDPFLG
AMIAEAMVLGYQGKDMQRNDEIMACVKHFALYGAGEGGRDYNTVDMSRQRMFNEYMLPYE
AAVEAGVGSVMASFNEVDGVPATANKWLMTDVLRGQWGFNGFVVTDYTGISEMIDHGIGD
LQTVSARAINAGVDMDMVSEGFVSTLKKSIQEGKVSMETLNTACRRILEAKYKLGLFDNP
YKYCDLKRPARDIFTKAHRDAARRIAAESFVLLKNDNVTLRPGTPAEPLLPFNPKGNIAV
IGPLADSRTNMPGTWSVAAVLDRCPSLVEGLKEMTAGKANILYAKGSNLISDASYEERAT
MFGRSLNRDNRTDEQLLNEALTVANQSDIIIAALGESSEMSGESSSRTDLNIPDVQQNLL
KELLKTGKPVVLVLFTGRPLTLTWEQEHVPAILNVWFGGSEAAYAIGDALFGYVNPGGKL
TMSFPKNVGQIPLYYAHKNTGRPLAQGKWFEKFRSNYLDVDNEPLYPFGYGLSYTTFSYG
DIDLSRSTIDMTGELTAAVMVTNTGTWPGSEVVQLYIRDLVGSTTRPVKELKGFQKIFLE
PGQSEIVRFKIAPEMLRYYNYDLQLVAEPGEFEVMIGTNSRDVKSARFTLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory