SitesBLAST
Comparing 353107 FitnessBrowser__Btheta:353107 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xreC Crystal structure of dgpa
26% identity, 53% coverage: 67:302/447 of query aligns to 32:238/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D73), I39 (≠ V74), T78 (= T116), P79 (= P117), N80 (≠ D118), H83 (= H121), E100 (= E138), K101 (= K139), P102 (= P140), F170 (≠ W220), Q176 (≠ R226), H187 (= H256)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
26% identity, 52% coverage: 72:302/447 of query aligns to 28:228/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K139), R150 (≠ N198), W157 (= W217), F160 (≠ W220), D173 (≠ N252), H177 (= H256)
- binding nicotinamide-adenine-dinucleotide: D51 (= D99), Y52 (≠ I100), C67 (≠ A115), T68 (= T116), P69 (= P117), H73 (= H121), E90 (= E138), K91 (= K139), P92 (= P140), Q119 (= Q167), V159 (≠ L219), F160 (≠ W220), Q166 (≠ R226)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
23% identity, 81% coverage: 42:401/447 of query aligns to 3:318/336 of 3ec7A
- active site: K97 (= K139), H176 (= H256)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ N50), M12 (≠ S51), I13 (≠ R52), D35 (= D73), I36 (≠ V74), R40 (= R81), T73 (≠ A115), A74 (≠ T116), S75 (≠ P117), N76 (≠ D118), H79 (= H121), E96 (= E138), K97 (= K139), M126 (≠ Q167), W271 (≠ P367), Y279 (= Y374)
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 51% coverage: 39:266/447 of query aligns to 5:198/347 of 3q2kC
- active site: K100 (= K139), H188 (= H256)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (vs. gap), K100 (= K139), W159 (= W195), T160 (≠ N199), R161 (= R200), Y165 (= Y214), N184 (= N252), Q185 (≠ N253), H188 (= H256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (vs. gap), R17 (vs. gap), I18 (vs. gap), D40 (= D73), T41 (≠ V74), A76 (= A115), T77 (= T116), S79 (≠ D118), H82 (= H121), Q85 (≠ A124), E99 (= E138), K100 (= K139), Q128 (≠ N166), W171 (= W220), R172 (≠ Q221)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 51% coverage: 41:266/447 of query aligns to 2:193/322 of 3q2kK
- active site: K95 (= K139), H183 (= H256)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (vs. gap), K95 (= K139), T155 (≠ N199), R156 (= R200), Y160 (= Y214), N179 (= N252), Q180 (≠ N253), H183 (= H256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G48), G11 (vs. gap), R12 (vs. gap), I13 (vs. gap), D35 (= D73), T36 (≠ V74), T72 (= T116), P73 (= P117), S74 (≠ D118), L76 (≠ W120), H77 (= H121), E94 (= E138), K95 (= K139), Q123 (≠ N166), W166 (= W220), R167 (≠ Q221), H183 (= H256)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
24% identity, 58% coverage: 42:302/447 of query aligns to 2:222/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ S51), F152 (≠ Y196), N154 (= N198), D175 (≠ N252), L176 (≠ N253), H179 (= H256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (≠ N50), F11 (≠ S51), M12 (≠ R52), D33 (= D73), L34 (≠ V74), T70 (≠ A115), T71 (= T116), P72 (= P117), N73 (≠ D118), L75 (≠ W120), H76 (= H121), Q79 (≠ A124), E93 (= E138), K94 (= K139), N122 (≠ Q167), W161 (≠ V227), H179 (= H256)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
24% identity, 58% coverage: 42:302/447 of query aligns to 2:222/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ S51), N154 (= N198), D175 (≠ N252), H179 (= H256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G48), G10 (≠ N50), F11 (≠ S51), M12 (≠ R52), D33 (= D73), L34 (≠ V74), T70 (≠ A115), T71 (= T116), P72 (= P117), N73 (≠ D118), L75 (≠ W120), H76 (= H121), Q79 (≠ A124), E93 (= E138), K94 (= K139), N122 (≠ Q167), W161 (≠ V227)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
24% identity, 58% coverage: 42:302/447 of query aligns to 2:222/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (≠ N50), F11 (≠ S51), M12 (≠ R52), D33 (= D73), L34 (≠ V74), T70 (≠ A115), T71 (= T116), P72 (= P117), N73 (≠ D118), L75 (≠ W120), H76 (= H121), Q79 (≠ A124), E93 (= E138), K94 (= K139), N122 (≠ Q167), W161 (≠ V227), H179 (= H256)
Sites not aligning to the query:
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
24% identity, 51% coverage: 39:266/447 of query aligns to 9:202/345 of 3q2iA
- active site: K104 (= K139), H192 (= H256)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K139), N133 (≠ R168), T164 (≠ Q221), R165 (≠ G222), Y169 (≠ N233), N188 (= N252), Q189 (≠ N253), H192 (= H256)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ V49), G20 (≠ N50), R21 (≠ S51), I22 (≠ R52), D44 (= D73), I45 (≠ V74), T81 (= T116), P82 (= P117), S83 (≠ D118), H86 (= H121), E103 (= E138), K104 (= K139), Q132 (= Q167), W175 (= W239), R176 (≠ H240), H192 (= H256)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
24% identity, 39% coverage: 36:208/447 of query aligns to 6:173/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (≠ N50), Y21 (≠ S51), F22 (≠ R52), L42 (≠ C72), D43 (= D73), P44 (≠ V74), A77 (= A115), T78 (= T116), P79 (= P117), N80 (≠ D118), H83 (= H121), E100 (= E138), K101 (= K139), V129 (≠ Q167), W170 (≠ T205), K171 (≠ G206)
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
25% identity, 35% coverage: 42:198/447 of query aligns to 5:158/342 of 3ceaA
- active site: K98 (= K139)
- binding nicotinamide-adenine-dinucleotide: G11 (= G48), G13 (≠ N50), R14 (≠ S51), L15 (≠ R52), L38 (≠ V74), Q42 (≠ A78), V74 (≠ A115), A75 (≠ T116), P76 (= P117), T77 (≠ D118), F79 (≠ W120), H80 (= H121), M83 (≠ A124), E97 (= E138), K98 (= K139), M127 (≠ Q167)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 64:152/336 of 5a06A
- active site: K101 (= K139)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I77 (≠ A115), T78 (= T116), P79 (= P117), N80 (≠ D118), L82 (≠ W120), H83 (= H121), E100 (= E138), K101 (= K139), R129 (≠ Q167)
- binding sorbitol: D72 (≠ E110), H96 (= H134), K101 (= K139), R122 (= R160), R122 (= R160), L124 (≠ V162)
Sites not aligning to the query:
- active site: 186
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 41, 59, 168, 169, 186, 264
- binding sorbitol: 2, 160, 169, 182, 186, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 64:152/336 of 5a03C
Sites not aligning to the query:
- active site: 186
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 14, 36, 37, 38, 41, 59, 168, 169, 186, 264
- binding beta-D-xylopyranose: 160, 169, 182, 186
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 63:151/335 of 5a05A
Sites not aligning to the query:
- active site: 185
- binding beta-D-glucopyranose: 159, 181, 185
- binding alpha-D-glucopyranose: 259, 262
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 58, 167, 168, 185, 263
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 63:151/335 of 5a04A
Sites not aligning to the query:
- active site: 185
- binding beta-D-glucopyranose: 159, 168, 181, 185
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 35, 36, 37, 40, 58, 167, 168, 185, 263
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 63:151/335 of 5a03E
Sites not aligning to the query:
- active site: 185
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 58, 167, 168, 185, 263
- binding beta-D-xylopyranose: 159, 168, 181, 185, 205, 207, 209
- binding alpha-D-xylopyranose: 268, 279, 280
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
33% identity, 20% coverage: 102:190/447 of query aligns to 63:151/335 of 5a02A
Sites not aligning to the query:
- active site: 185
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 35, 36, 37, 40, 58, 167, 168, 185, 263
2ixaA A-zyme, n-acetylgalactosaminidase (see paper)
32% identity, 22% coverage: 40:138/447 of query aligns to 1:103/426 of 2ixaA
- binding nicotinamide-adenine-dinucleotide: A9 (≠ G48), G11 (≠ N50), L12 (≠ S51), R13 (= R52), D34 (= D73), P35 (≠ V74), M39 (≠ A78), N62 (≠ E97), S80 (≠ A115), S81 (≠ T116), P82 (= P117), W83 (≠ D118), W85 (= W120), H86 (= H121), H89 (≠ A124), E103 (= E138)
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
26% identity, 35% coverage: 42:198/447 of query aligns to 3:157/339 of 4mjlD
- active site: K97 (= K139)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K139), H155 (≠ Y196), N157 (= N198)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ N50), A12 (≠ S51), M13 (≠ R52), D35 (= D73), I36 (≠ V74), V73 (≠ A115), S74 (≠ T116), H79 (= H121), E96 (= E138), K97 (= K139), M126 (≠ Q167)
Sites not aligning to the query:
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: 172, 173, 176, 236
- binding nicotinamide-adenine-dinucleotide: 172, 274, 282
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
26% identity, 35% coverage: 42:198/447 of query aligns to 3:157/339 of 4mioD
- active site: K97 (= K139)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K139), H155 (≠ Y196), N157 (= N198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ S51), M13 (≠ R52), D35 (= D73), I36 (≠ V74), S74 (≠ T116), A78 (≠ W120), H79 (= H121), E96 (= E138), K97 (= K139), M126 (≠ Q167)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 172, 173, 176, 236
- binding 1,4-dihydronicotinamide adenine dinucleotide: 172, 274, 282
Query Sequence
>353107 FitnessBrowser__Btheta:353107
MTTRRDFIKKTVAGTAALSLGSIIPGFGSNSYQEILGANEKIRIGVIGVNSRGNALAQGF
AKMKGCEVTYLCDVDSRALERCQADIHKISGRTPKGEKDIRKMLESDDFEAVVIATPDHW
HGKAAIMAMQAGKHVYLEKPTSHNPAENEMLVRATLKYNRIVQVGNQRRSWPNVIKAIEE
IKSGAIGKVRYAKSWYVNNRPSIGTGKVVPVPDYLDWDLWQGPAPRVPNFKDNYIHYNWH
WFWNWGTGEALNNGTHFVDILRWGLGVDYPTKVDSVGGRYRFQDDWQTPDTQLITFQFGD
EASCSWEGRSCNSTPVDGYGVGTAFYGETGTLFISGGNEYKITDLQGKVIKDVKSNLKFE
TGNLLNPSEKLDAYHFENWFDAIRKGGKLNSGIVDACISTQLVQLGNIAQRVGHSLDIDP
GSGRILNDLEANKLWGREYEKGWEIRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory