Comparing 353114 FitnessBrowser__Btheta:353114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
30% identity, 99% coverage: 2:393/395 of query aligns to 2:387/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
30% identity, 99% coverage: 2:393/395 of query aligns to 3:388/396 of O34450
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
33% identity, 92% coverage: 29:390/395 of query aligns to 27:374/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
33% identity, 92% coverage: 29:390/395 of query aligns to 28:375/379 of 3iv8A
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
30% identity, 99% coverage: 5:394/395 of query aligns to 11:381/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
30% identity, 99% coverage: 5:394/395 of query aligns to 11:381/385 of 6fv4B
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
30% identity, 86% coverage: 57:395/395 of query aligns to 43:363/363 of 1o12A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
30% identity, 94% coverage: 23:395/395 of query aligns to 21:382/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 94% coverage: 23:395/395 of query aligns to 21:382/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
30% identity, 94% coverage: 23:395/395 of query aligns to 21:382/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
31% identity, 94% coverage: 23:395/395 of query aligns to 21:381/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
29% identity, 94% coverage: 23:395/395 of query aligns to 21:356/356 of 2p50B
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
30% identity, 99% coverage: 3:394/395 of query aligns to 6:398/401 of 7nutA
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
28% identity, 98% coverage: 5:392/395 of query aligns to 9:349/350 of 6fv3D
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
29% identity, 94% coverage: 23:395/395 of query aligns to 20:334/334 of 1yrrB
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
30% identity, 94% coverage: 21:390/395 of query aligns to 26:381/385 of 6jkuA
Q5HGN1 Dihydroorotase; DHOase; EC 3.5.2.3 from Staphylococcus aureus (strain COL)
26% identity, 59% coverage: 5:238/395 of query aligns to 3:248/424 of Q5HGN1
Sites not aligning to the query:
3griB The crystal structure of a dihydroorotase from staphylococcus aureus
26% identity, 59% coverage: 5:238/395 of query aligns to 3:248/423 of 3griB
Sites not aligning to the query:
7cf6A Crystal structure of beta-aspartyl dipeptidase from thermophilic keratin degrading fervidobacterium islandicum aw-1 in complex with beta-asp-leu dipeptide (see paper)
31% identity, 22% coverage: 305:392/395 of query aligns to 280:372/384 of 7cf6A
Sites not aligning to the query:
>353114 FitnessBrowser__Btheta:353114
MERLIIINGELILPTGIETNKIMVCRNGKIEQIVSSEAYIPQADDRIIDANQQYVSPGFI
DIHVHGGGGHDFMDGTVEAFLGVAETHARYGTTAMVPTTLTSTNEELMTTFAVYQKAKSL
NKKGAQFIGLHLEGPYFSPKQCGAQDPNHLKTPHPDEYNTILEASQDIVRWSIAPELAGA
IELGEKLNSCHILPSIAHTDAIYEEVVKAYEAGYTHITHLYSAMSTITRRNAYRYAGVVE
AAYLIDGMTVEIIADGIHLPKPLLQFVYKFKGADKTALCTDAMRGAGMPDGESILGSLTN
GQKVIIEDGVAKLPDRSAFAGSVATADRLVRTMINIAGIPLIDAIRMITLTPARILHVDS
QKGSLEEGKDADIVTFDNQINVTTTISKGHVIYNQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory