SitesBLAST
Comparing 353132 BT3606 sugar-proton symporter (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
36% identity, 100% coverage: 1:468/468 of query aligns to 1:483/491 of P0AGF4
- F24 (= F24) mutation to A: Decreases xylose transport.
- G83 (= G75) mutation to A: Abolishes xylose transport.
- R133 (= R107) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E127) mutation to A: Abolishes xylose transport.
- R160 (= R134) mutation to A: Abolishes xylose transport.
- Q168 (= Q142) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ G275) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ GQ 275:276) binding
- Q289 (= Q276) mutation to A: Strongly decreases xylose transport.
- N294 (= N281) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y285) mutation to A: Abolishes xylose transport.
- N325 (= N312) mutation to A: No effect on xylose transport.
- G340 (= G327) mutation to A: Abolishes xylose transport.
- R341 (= R328) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ F383) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E388) mutation to A: Abolishes xylose transport.
- R404 (= R395) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ L406) binding
- W416 (= W407) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
37% identity, 98% coverage: 6:463/468 of query aligns to 2:474/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
37% identity, 98% coverage: 6:463/468 of query aligns to 2:474/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
37% identity, 98% coverage: 6:463/468 of query aligns to 2:474/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
36% identity, 98% coverage: 9:467/468 of query aligns to 6:446/446 of A0A0H2VG78
- D22 (= D27) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R107) mutation to A: Loss of transport activity.
- I105 (≠ G110) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E127) mutation to A: Loss of transport activity.
- Q137 (= Q142) mutation to A: Loss of transport activity.
- Q250 (≠ G275) mutation to A: Loss of transport activity.
- Q251 (= Q276) mutation to A: Loss of transport activity.
- N256 (= N281) mutation to A: Loss of transport activity.
- W357 (≠ F383) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 98% coverage: 9:465/468 of query aligns to 30:481/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 99% coverage: 2:466/468 of query aligns to 78:552/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
26% identity, 98% coverage: 9:466/468 of query aligns to 4:472/487 of 7aaqA
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 98% coverage: 9:466/468 of query aligns to 24:492/514 of Q9LT15
- F39 (= F24) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ T28) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (vs. gap) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E127) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q142) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ F149) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (≠ G275) binding
- Q296 (= Q276) binding
- N301 (= N281) binding
- N332 (= N312) binding
- D344 (= D324) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (≠ F383) binding
- C449 (≠ Q422) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
25% identity, 98% coverage: 9:466/468 of query aligns to 9:477/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ T28), I90 (≠ L70), H94 (≠ I74), V98 (≠ R78), F101 (≠ I81), N138 (≠ S118), P142 (= P122), N158 (≠ V138), F161 (≠ Y141), Q162 (= Q142), I165 (≠ V145), D210 (≠ E206), G391 (≠ C379), P392 (≠ A380), W395 (≠ F383), M419 (≠ W407)
- binding beta-D-glucopyranose: Q280 (≠ G275), N286 (= N281), M289 (≠ L284), G391 (≠ C379), W395 (≠ F383)
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 73% coverage: 9:350/468 of query aligns to 27:363/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 75% coverage: 2:350/468 of query aligns to 19:364/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
P39004 High-affinity hexose transporter HXT7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 97% coverage: 13:465/468 of query aligns to 68:530/570 of P39004
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P39003 High-affinity hexose transporter HXT6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 97% coverage: 13:465/468 of query aligns to 68:530/570 of P39003
Sites not aligning to the query:
- 560 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
27% identity, 99% coverage: 1:463/468 of query aligns to 1:465/493 of P32037
- N43 (≠ Q43) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
26% identity, 97% coverage: 10:463/468 of query aligns to 10:465/496 of P11169
- Q159 (= Q142) binding
- QLS 277:279 (≠ AIL 272:274) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (≠ GQ 275:276) binding
- N286 (= N281) binding
- N315 (= N312) binding
- E378 (≠ A375) binding
- W386 (≠ F383) binding
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
26% identity, 97% coverage: 10:461/468 of query aligns to 8:461/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (= T28), A66 (= A56), S69 (vs. gap), Q157 (= Q142), I164 (≠ F149), Q278 (≠ G275), Q279 (= Q276), N284 (= N281), N313 (= N312), F375 (≠ C374), W384 (≠ F383), N411 (≠ T410), F412 (≠ Y411), G415 (= G414)
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
26% identity, 97% coverage: 10:461/468 of query aligns to 10:463/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (= Q142), I166 (≠ F149), Q280 (≠ G275), Q281 (= Q276), N286 (= N281), F377 (≠ C374), W386 (≠ F383)
- binding alpha-D-glucopyranose: Q159 (= Q142), I162 (≠ V145), I166 (≠ F149), Q280 (≠ G275), Q281 (= Q276), N286 (= N281), W386 (≠ F383)
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 97% coverage: 10:461/468 of query aligns to 7:460/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F24), T25 (= T28), N29 (≠ S32), Q156 (= Q142), I163 (≠ F149), Q278 (= Q276), F286 (≠ L284), A308 (≠ V308), N312 (= N312), F374 (≠ C374), E375 (≠ A375), N406 (≠ L406), W407 (= W407), N410 (≠ T410)
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
26% identity, 97% coverage: 10:461/468 of query aligns to 10:463/470 of 7sptA
Query Sequence
>353132 BT3606 sugar-proton symporter (NCBI ptt file)
MKTTINLGYIIFLSVVAALGGFLFGYDTAVISGTIAQVTHLFQLDTLQQGWYVGCALIGS
IVGVLFSGILSDSIGRKRTMILSAILFSTSAIGCAFCIDFNQLVVYRIIGGIGIGVVSIV
SPLYISEVSVAQFRGRMVSLYQLAVTVGFLGAYLVNYQLLAYSESGNHLPIAWLEKIVVT
EVWRGMLGMETLPAIIFFIIIFFIPESPRWLIVKGQERKATYILEKIYNSFKEADFQLNE
TKSVLVSETRSEWSILLKPGILKAVIIGVCIAILGQFMGVNAVLYYGPSIFENAGLSGGD
SLFYQVLVGLVNTLTTILALLIIDKVGRKKLIYYGVSGMVVSLILIGSYFLFGNAWNISS
LFLLAFFLCYVFCCAISICAVIFVLLSEMYPTKIRGLAMSIAGFALWIGTYLIGQLTPWM
LQNLTPAGTFFLFAIMCVPYMLIVWKLVPETTGKSLEEIERYWTRSER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory