SitesBLAST
Comparing 353143 FitnessBrowser__Btheta:353143 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
31% identity, 99% coverage: 1:336/338 of query aligns to 4:335/337 of 4ilkA
- active site: C40 (= C37), G41 (= G38), S42 (= S39), H45 (≠ N42), H59 (= H59), E60 (= E60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), A107 (≠ E108), P145 (= P145), A149 (≠ G149), K332 (≠ R333)
- binding manganese (ii) ion: C40 (= C37), H59 (= H59), E60 (= E60), E144 (= E144)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G168), G170 (= G170), P171 (≠ M171), I172 (= I172), D193 (= D191), R194 (≠ L192), R198 (≠ K196), N213 (≠ S211), A235 (= A235), A236 (≠ V236), C237 (≠ G237), I241 (≠ T241), M258 (≠ I258), F260 (≠ Y260)
- binding zinc ion: C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
31% identity, 95% coverage: 1:321/338 of query aligns to 4:331/347 of 2eerB
- active site: C38 (= C37), H39 (≠ G38), S40 (= S39), H43 (≠ N42), H68 (= H59), E69 (= E60), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), R116 (≠ E108), C154 (≠ P145), T158 (≠ G149)
- binding nicotinamide-adenine-dinucleotide: C38 (= C37), H39 (≠ G38), S40 (= S39), H43 (≠ N42), C154 (≠ P145), T158 (≠ G149), G178 (= G168), G181 (≠ M171), G182 (= G173), L183 (≠ I174), D203 (= D191), V204 (≠ L192), R205 (≠ D193), L247 (≠ A235), N248 (≠ V236), V270 (≠ I258), G271 (= G259), L272 (≠ Y260), F273 (≠ A261), L295 (≠ R283), V296 (≠ N284)
- binding zinc ion: E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104)
Sites not aligning to the query:
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
32% identity, 96% coverage: 13:335/338 of query aligns to 16:345/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ N42), H65 (= H59), E66 (= E60), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), K113 (≠ E108), P151 (= P145), A155 (≠ G149), K340 (= K330)
- binding nicotinamide-adenine-dinucleotide: G175 (= G170), P176 (≠ M171), L177 (≠ I172), E197 (≠ D191), P198 (≠ L192), R202 (≠ K196), F241 (≠ A235), S242 (≠ V236), A244 (≠ S238), L264 (≠ I258), G265 (= G259), L266 (≠ Y260), I289 (vs. gap), T290 (≠ S282)
- binding zinc ion: C95 (= C90), C101 (= C96), C109 (= C104)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
32% identity, 96% coverage: 13:335/338 of query aligns to 18:347/348 of O58389
- C42 (= C37) binding
- T44 (≠ S39) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C90) binding
- C100 (= C93) binding
- C103 (= C96) binding
- C111 (= C104) binding
- E152 (= E144) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I172) binding
- E199 (≠ D191) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K196) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ IGY 258:260) binding
- IT 291:292 (≠ -S 282) binding
- R294 (≠ N284) mutation to A: 4000-fold decrease in catalytic efficiency.
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
32% identity, 93% coverage: 16:331/338 of query aligns to 23:350/357 of 7y9pA
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
35% identity, 89% coverage: 1:301/338 of query aligns to 1:303/339 of 1rjwA
- active site: C38 (= C37), H39 (≠ G38), T40 (≠ S39), H43 (≠ N42), H61 (= H59), E62 (= E60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), K110 (≠ E108), C148 (≠ P145), T152 (≠ G149)
- binding trifluoroethanol: T40 (≠ S39), C148 (≠ P145), I285 (≠ R283)
- binding zinc ion: C38 (= C37), H61 (= H59), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
30% identity, 93% coverage: 9:323/338 of query aligns to 11:330/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (≠ N42), H65 (≠ I65), E66 (= E66), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), D113 (≠ E108), P153 (= P145), G157 (= G149)
- binding magnesium ion: H65 (≠ I65), E66 (= E66), E152 (= E144)
- binding zinc ion: C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104)
Sites not aligning to the query:
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
35% identity, 89% coverage: 1:301/338 of query aligns to 1:303/337 of 3piiA
- active site: C38 (= C37), H39 (≠ G38), T40 (≠ S39), H43 (≠ N42), H61 (= H59), E62 (= E60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), K110 (≠ E108), C148 (≠ P145), T152 (≠ G149)
- binding butyramide: T40 (≠ S39), H61 (= H59), W87 (vs. gap), C148 (≠ P145)
- binding zinc ion: C38 (= C37), H61 (= H59), E62 (= E60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), C148 (≠ P145)
Sites not aligning to the query:
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
35% identity, 86% coverage: 12:301/338 of query aligns to 13:303/337 of P12311
- C38 (= C37) mutation to S: No activity.
- T40 (≠ S39) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ N42) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
29% identity, 98% coverage: 1:331/338 of query aligns to 3:341/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ N42), H65 (= H59), E66 (= E60), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), K113 (≠ E108), P151 (= P145), A155 (≠ G149), K340 (= K330)
- binding nicotinamide-adenine-dinucleotide: G173 (= G168), G175 (= G170), P176 (≠ M171), L177 (≠ I172), S196 (≠ V190), E197 (≠ D191), P198 (≠ L192), R202 (≠ K196), F241 (≠ A235), S242 (≠ V236), A244 (≠ S238), L264 (≠ I258), G265 (= G259), L266 (≠ Y260), I289 (vs. gap), T290 (≠ S282)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
29% identity, 98% coverage: 1:331/338 of query aligns to 5:343/350 of Q5JI69
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
31% identity, 83% coverage: 1:281/338 of query aligns to 2:283/339 of 5kiaA
- active site: C37 (= C37), G38 (= G38), T39 (≠ S39), H42 (≠ N42), H61 (= H59), E62 (= E60), C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104), V109 (≠ E108), P147 (= P145), A151 (≠ G149)
- binding calcium ion: D146 (≠ E144), N150 (≠ V148)
- binding zinc ion: C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
30% identity, 98% coverage: 1:331/338 of query aligns to 5:339/348 of 5ylnA
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
31% identity, 91% coverage: 26:334/338 of query aligns to 27:345/346 of 4uejA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), P43 (≠ N42), H59 (= H59), E60 (= E60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D107 (≠ E108), P145 (= P145), G149 (= G149), K341 (= K330)
- binding glycerol: H59 (= H59), E144 (= E144)
- binding zinc ion: C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104)
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
31% identity, 91% coverage: 26:334/338 of query aligns to 27:345/346 of 4a2cA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), P43 (≠ N42), H59 (= H59), E60 (= E60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D107 (≠ E108), P145 (= P145), G149 (= G149), K341 (= K330)
- binding zinc ion: C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104)
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
30% identity, 92% coverage: 12:323/338 of query aligns to 13:333/344 of 1h2bB
- active site: C39 (= C37), H40 (≠ G38), T41 (≠ S39), H44 (≠ N42), H64 (= H59), E65 (= E60), D94 (≠ C90), C97 (= C93), C100 (= C96), C108 (= C104), E112 (= E108), D153 (vs. gap), T157 (≠ V148)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C37), H40 (≠ G38), T41 (≠ S39), H44 (≠ N42), T157 (≠ V148), V180 (≠ C169), G181 (= G170), G182 (≠ M171), L183 (≠ I172), D203 (= D191), V204 (≠ L192), K208 (= K196), F246 (≠ A235), V247 (= V236), T252 (= T241), Y255 (≠ M244), V269 (≠ I258), G270 (= G259), Y271 (= Y260), L293 (≠ R283), V294 (≠ N284)
- binding octanoic acid (caprylic acid): T41 (≠ S39), W50 (≠ N48), H64 (= H59), D153 (vs. gap), V294 (≠ N284)
- binding zinc ion: C39 (= C37), H64 (= H59), D94 (≠ C90), C97 (= C93), C100 (= C96), C108 (= C104), D153 (vs. gap)
Sites not aligning to the query:
1r37A Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(h) and 2-ethoxyethanol (see paper)
28% identity, 95% coverage: 1:321/338 of query aligns to 1:331/347 of 1r37A
- active site: C38 (= C37), H39 (≠ G38), S40 (= S39), H43 (≠ N42), H68 (= H59), E69 (= E60), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), R116 (≠ E108), C154 (vs. gap), T158 (≠ V148)
- binding 2-ethoxyethanol: S40 (= S39), F49 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: C38 (= C37), H39 (≠ G38), S40 (= S39), H43 (≠ N42), C154 (vs. gap), T158 (≠ V148), G181 (≠ C169), G182 (= G170), L183 (≠ M171), D203 (= D191), V204 (≠ L192), R205 (≠ D193), L247 (≠ A235), N248 (≠ V236), V270 (≠ I258), G271 (= G259), L272 (≠ Y260), F273 (≠ A261), L295 (≠ R283), V296 (≠ N284)
- binding zinc ion: C38 (= C37), H68 (= H59), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), C154 (vs. gap)
Sites not aligning to the query:
1jvbA Alcohol dehydrogenase from the archaeon sulfolobus solfataricus (see paper)
28% identity, 95% coverage: 1:321/338 of query aligns to 1:331/347 of 1jvbA
- active site: C38 (= C37), H39 (≠ G38), S40 (= S39), H43 (≠ N42), H68 (= H59), E69 (= E60), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), R116 (≠ E108), C154 (vs. gap), T158 (≠ V148)
- binding zinc ion: C38 (= C37), H68 (= H59), E69 (= E60), E98 (≠ C90), C101 (= C93), C104 (= C96), C112 (= C104), C154 (vs. gap)
Sites not aligning to the query:
P39462 NAD-dependent alcohol dehydrogenase; EC 1.1.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 95% coverage: 1:321/338 of query aligns to 1:331/347 of P39462
- K11 (≠ N8) modified: N6-methyllysine; partial
- K213 (= K201) modified: N6-methyllysine; partial
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
29% identity, 83% coverage: 1:281/338 of query aligns to 1:285/341 of P07913
- C38 (= C37) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
Query Sequence
>353143 FitnessBrowser__Btheta:353143
MKAVQIVNPSEMKVVELEKPTVGAGEVLVRIKYVGFCGSDLNTFLGRNPMVKLPVIPGHE
VGAVIEEIGPDVPAGFEKGMNVTLNPYTNCGKCASCRNGRVNACEHNETLGVQRNGVMCE
YAVLPWTKIIPAGNISSRDCALIEPMSVGFHAVSRAQVIDNEYVMVIGCGMIGIGAIVRA
ALRGATVIAVDLDDEKLVLAKRVGASYAVNSKTENVHERIQEITAGFGADVVIEAVGSPV
TYVMAVDEVGFTGRVVCIGYAKKEVAFQTKYFVQKELDIRGSRNALPADFRAVINYMKEG
KCPVEELISKIAKPEDALEAMKEWAADPGKVFRILVEM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory