SitesBLAST
Comparing 353162 FitnessBrowser__Btheta:353162 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
52% identity, 99% coverage: 1:332/335 of query aligns to 5:343/346 of Q04797
- S98 (= S95) modified: Phosphoserine
- Y146 (≠ S144) modified: Phosphotyrosine
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), A71 (= A71), T75 (= T75), G160 (= G161), M161 (≠ A162), G162 (≠ A163)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R98), N126 (= N127), C127 (= C128), Q154 (= Q155), G158 (= G159), E219 (= E209), K222 (= K212), R244 (= R233)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G72), S73 (≠ A73), T94 (≠ S94), S95 (= S95), R98 (= R98), K222 (= K212)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), N93 (= N93), T94 (≠ S94), N126 (= N127), C127 (= C128), G160 (= G161), G328 (= G317)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S70), G72 (= G72), S73 (≠ A73), N93 (= N93), T94 (≠ S94), S95 (= S95), R98 (= R98), K222 (= K212)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), A71 (= A71), G160 (= G161), M161 (≠ A162), G162 (≠ A163)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 4r3nA
- active site: C127 (= C128), Q154 (= Q155), R244 (= R233), H251 (= H240)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ A73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N127), K222 (= K212)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), N93 (= N93), T94 (≠ S94), N126 (= N127), C127 (= C128), G160 (= G161), M161 (≠ A162), G328 (= G317)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R98), N126 (= N127), G158 (= G159), I208 (= I198), E219 (= E209), K222 (= K212), R244 (= R233)
- binding adenosine-2'-5'-diphosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), A71 (= A71), T75 (= T75), G160 (= G161), M161 (≠ A162)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), A71 (= A71), T75 (= T75), G160 (= G161)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R98), N126 (= N127), G158 (= G159), A159 (= A160), E219 (= E209), K222 (= K212), R244 (= R233)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 2gz3A
- active site: C127 (= C128), Q154 (= Q155), R244 (= R233), H251 (= H240)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C128), Q154 (= Q155), G158 (= G159), E219 (= E209), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), N93 (= N93), G158 (= G159), G160 (= G161), M161 (≠ A162), N324 (≠ Q313), A329 (= A318)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 2gz2A
- active site: C127 (= C128), Q154 (= Q155), R244 (= R233), H251 (= H240)
- binding adenosine-2'-5'-diphosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), A71 (= A71), T75 (= T75)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/357 of 2gz1A
- active site: C127 (= C128), Q154 (= Q155), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), N93 (= N93), S157 (= S158), G158 (= G159), G160 (= G161), M161 (≠ A162), N324 (≠ Q313), L325 (≠ I314)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ A73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N127), C127 (= C128), Q154 (= Q155), G158 (= G159), K222 (= K212), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), N93 (= N93), T94 (≠ S94), P125 (= P126), N126 (= N127), C127 (= C128), G160 (= G161), M161 (≠ A162), G328 (= G317)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N127), C127 (= C128), Q154 (= Q155), G158 (= G159), E219 (= E209), K222 (= K212), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), N93 (= N93), T94 (≠ S94), N126 (= N127), C127 (= C128), G160 (= G161), M161 (≠ A162), G328 (= G317)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R98), G158 (= G159), E219 (= E209), K222 (= K212), R244 (= R233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), R38 (= R37), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), T75 (= T75), C127 (= C128), S157 (= S158), G158 (= G159), G160 (= G161), M161 (≠ A162), N324 (≠ Q313), L325 (≠ I314)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), T10 (≠ S9), G11 (= G10), A12 (= A11), V13 (= V12), A35 (≠ G34), S36 (= S35), S39 (= S38), T56 (≠ L55), S70 (= S70), A71 (= A71), G72 (= G72), N93 (= N93), T94 (≠ S94), N126 (= N127), C127 (= C128), G160 (= G161), M161 (≠ A162), G328 (= G317)
- binding phthalic acid: S73 (≠ A73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N127), K222 (= K212)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
47% identity, 98% coverage: 3:329/335 of query aligns to 4:340/361 of 3pylC
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
47% identity, 99% coverage: 1:331/335 of query aligns to 5:334/337 of P23247
- C132 (= C128) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
47% identity, 99% coverage: 1:331/335 of query aligns to 4:333/336 of 2r00C
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
42% identity, 98% coverage: 1:329/335 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C128), Q156 (= Q155), R248 (= R233), H255 (= H240)
- binding cysteine: C129 (= C128), Q156 (= Q155), G160 (= G159), E223 (= E209), R248 (= R233), H255 (= H240)
- binding glycerol: S108 (≠ P108), G187 (vs. gap), F192 (vs. gap), P201 (≠ Q189), Q225 (≠ M211), R228 (≠ Y214), F229 (≠ N215), Q335 (= Q324), E338 (= E327), L339 (≠ Y328)
- binding sulfate ion: R98 (= R98), H117 (≠ L116), R119 (= R118), N128 (= N127), C129 (= C128), K226 (= K212), E270 (= E255), R273 (= R258)
1ys4A Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii (see paper)
32% identity, 99% coverage: 1:331/335 of query aligns to 3:345/348 of 1ys4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G7), T11 (≠ S9), G12 (= G10), S13 (≠ A11), V14 (= V12), A35 (≠ G34), S36 (= S35), S39 (= S38), L89 (≠ T75), N107 (= N93), S181 (= S158), G182 (= G159), A183 (= A160), G184 (= G161), N327 (≠ Q313), T328 (≠ I314)
Query Sequence
>353162 FitnessBrowser__Btheta:353162
MKVAIVGVSGAVGQEFLRVLDERNFPMDELVLFGSKRSAGTTYTFRGKQIEVKLLQHNDD
FKGVDIAFTSAGAGTSKEFEKTITKYGAVMIDNSSAFRMDADVPLVVPEVNAADALERPR
GVIANPNCTTIQMVVALKAIEQLSHIKTVHVSTYQAASGAGAAAMDELYEQYRQVLANEP
VTVEKFAYQLAFNLIPQIDVFTENGYTKEEMKMYNETRKIMHSDVKVSATCVRVPALRAH
SESIWVETERPISVEEAREAFAKGEGLVLQDNPAEKEYPMPLFLAGKDPVYVGRIRKDLT
NENGLTFWIVGDQIKKGAALNAVQIAEYLIKVKNV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory