Comparing 353166 FitnessBrowser__Btheta:353166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
49% identity, 99% coverage: 1:215/218 of query aligns to 3:216/223 of 2pclA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 99% coverage: 1:215/218 of query aligns to 5:223/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
45% identity, 99% coverage: 1:215/218 of query aligns to 2:220/222 of 7arlD
7mdyC Lolcde nucleotide-bound
45% identity, 99% coverage: 1:215/218 of query aligns to 2:220/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
44% identity, 99% coverage: 1:215/218 of query aligns to 4:222/229 of 7v8iD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
47% identity, 100% coverage: 1:218/218 of query aligns to 3:223/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
45% identity, 100% coverage: 1:218/218 of query aligns to 1:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
44% identity, 100% coverage: 1:218/218 of query aligns to 1:226/230 of 1l2tA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 100% coverage: 1:218/218 of query aligns to 4:224/648 of P75831
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 3:223/592 of 5lj7A
8g4cB Bceabs atpgs high res tm (see paper)
42% identity, 96% coverage: 7:215/218 of query aligns to 9:221/248 of 8g4cB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 3:223/615 of 5lilA
7tchB Bceab e169q variant atp-bound conformation (see paper)
41% identity, 96% coverage: 7:215/218 of query aligns to 8:220/245 of 7tchB
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 94% coverage: 13:218/218 of query aligns to 20:224/650 of 5ws4A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
44% identity, 99% coverage: 1:215/218 of query aligns to 1:214/240 of 4ymuJ
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 97% coverage: 1:211/218 of query aligns to 1:208/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
41% identity, 97% coverage: 1:211/218 of query aligns to 1:208/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
40% identity, 97% coverage: 1:211/218 of query aligns to 1:208/218 of 8hd0A
3c4jA Abc protein artp in complex with atp-gamma-s
40% identity, 99% coverage: 1:215/218 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
40% identity, 99% coverage: 1:215/218 of query aligns to 3:216/242 of 3c41J
>353166 FitnessBrowser__Btheta:353166
MIKLEGITKSFGSLQVLKGIDLEINKGEIVSIVGPSGAGKTTLLQIMGTLDEPDAGTVAI
DGTVVSRMKEKELSAFRNKNIGFVFQFHQLLPEFTALENVMIPAFIAGVSSKEANERAME
ILAFMGLTDRASHKPNELSGGEKQRVAVARALINHPAVILADEPSGSLDTHNKEDLHQLF
FDLRDRLGQTFVIVTHDEGLAKITDRTVHMVDGTIKKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory