SitesBLAST
Comparing 353168 FitnessBrowser__Btheta:353168 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S22), A19 (= A23), G21 (= G25), L22 (= L26), G23 (= G27), Y101 (= Y105), F223 (= F226), T224 (≠ S227), S226 (= S229), M229 (= M232), L321 (= L329)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/446 of 6yu6B
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
47% identity, 97% coverage: 6:449/456 of query aligns to 2:439/441 of 4us3A
- binding sodium ion: G17 (= G21), A19 (= A23), V20 (= V24), V20 (= V24), G21 (= G25), N24 (= N28), T224 (≠ S227), D256 (= D259), A313 (= A321), S316 (≠ T324), S317 (= S325)
- binding tryptophan: S18 (= S22), A19 (= A23), L22 (= L26), G23 (= G27), Y101 (= Y105), F223 (= F226), T224 (≠ S227), S226 (= S229), M229 (= M232), S320 (= S328), L321 (= L329)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
47% identity, 96% coverage: 14:449/456 of query aligns to 1:430/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ I186), T180 (= T193), I287 (≠ A299), R288 (≠ F300), L289 (≠ S301)
- binding sodium ion: G8 (= G21), S9 (= S22), A10 (= A23), V11 (= V24), V11 (= V24), N15 (= N28), T215 (≠ S227), D247 (= D259), A304 (= A321), S307 (≠ T324), S308 (= S325)
- binding tryptophan: S9 (= S22), A10 (= A23), G12 (= G25), G14 (= G27), Y92 (= Y105), F214 (= F226), T215 (≠ S227), S217 (= S229), M220 (= M232), L312 (= L329)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:456/501 of 3gwwA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F244 (= F226), T245 (≠ S227), S247 (= S229), F250 (≠ M232), I350 (≠ L329)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L26), G22 (= G27), R26 (= R31), Y104 (= Y105), A310 (≠ G284), F311 (≠ P285), D392 (= D382), D395 (= D385)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
31% identity, 98% coverage: 4:448/456 of query aligns to 1:461/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (= R31), Q32 (≠ E35), R189 (≠ K171), F190 (≠ S172), I193 (= I175), F316 (≠ P285), F346 (≠ M320), L396 (≠ F381), D397 (= D382)
- binding leucine: A20 (= A23), G22 (= G25), G24 (= G27), Y106 (= Y105), F249 (= F226), T250 (≠ S227), S252 (= S229), F255 (≠ M232)
- binding sodium ion: G18 (= G21), A20 (= A23), V21 (= V24), V21 (= V24), G22 (= G25), N25 (= N28), T250 (≠ S227), N282 (≠ D259), A347 (= A321), T350 (= T324), S351 (= S325)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:458/502 of 3uslA
- binding selenomethionine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F246 (= F226), T247 (≠ S227), S249 (= S229), S348 (= S325), I352 (≠ L329)
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ D259), A344 (= A321), T347 (= T324), S348 (= S325)
- binding phosphocholine: N83 (≠ G84), R84 (≠ T85), F85 (≠ H86)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:458/502 of 3usgA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), F246 (= F226), T247 (≠ S227), S249 (= S229), F252 (≠ M232)
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ D259), A344 (= A321), T347 (= T324), S348 (= S325)
- binding phosphocholine: N83 (≠ G84), R84 (≠ T85)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:458/504 of 3f3aA
- binding sodium ion: G16 (= G21), N17 (≠ S22), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T247 (≠ S227), N279 (≠ D259), A344 (= A321), T347 (= T324), S348 (= S325)
- binding tryptophan: R7 (≠ K12), A18 (= A23), G20 (= G25), L21 (= L26), G22 (= G27), R26 (= R31), Y104 (= Y105), G242 (= G222), F246 (= F226), F246 (= F226), T247 (≠ S227), S249 (= S229), F252 (≠ M232), D265 (≠ E245), Q266 (≠ T246), D267 (≠ N247), F299 (vs. gap), N303 (vs. gap), A306 (≠ G278), I307 (= I279), A310 (≠ D282), N314 (≠ S286), S348 (= S325), I352 (≠ L329), D397 (= D385), G401 (≠ A389), T402 (≠ K390), G432 (≠ D420)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
31% identity, 97% coverage: 5:448/456 of query aligns to 1:460/511 of 2qeiA
- binding alanine: A19 (= A23), G21 (= G25), G23 (= G27), Y105 (= Y105), F248 (= F226), T249 (≠ S227), S251 (= S229)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (= R31), V30 (≠ Y34), Q31 (≠ E35), Y104 (= Y104), R180 (≠ K163), R188 (≠ K171), F189 (≠ S172), F315 (≠ P285), F345 (≠ M320), D396 (= D382), D399 (= D385)
- binding sodium ion: G17 (= G21), A19 (= A23), V20 (= V24), V20 (= V24), G21 (= G25), N24 (= N28), T249 (≠ S227), N281 (≠ D259), A346 (= A321), T349 (= T324), S350 (= S325)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
31% identity, 97% coverage: 5:448/456 of query aligns to 1:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (= R31), V30 (≠ Y34), Q31 (≠ E35), R188 (≠ K171), F189 (≠ S172), I192 (= I175), A314 (≠ G284), F315 (≠ P285), F345 (≠ M320), D396 (= D382)
- binding leucine: A19 (= A23), G21 (= G25), L22 (= L26), G23 (= G27), Y105 (= Y105), F248 (= F226), T249 (≠ S227), S251 (= S229), F254 (≠ M232)
- binding sodium ion: G17 (= G21), A19 (= A23), V20 (= V24), V20 (= V24), G21 (= G25), N24 (= N28), T249 (≠ S227), N281 (≠ D259), A346 (= A321), T349 (= T324), S350 (= S325)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:459/509 of 3gwuA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F247 (= F226), T248 (≠ S227), S250 (= S229), F253 (≠ M232)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W30), R26 (= R31), Y104 (= Y105), F247 (= F226), A313 (≠ G284), D395 (= D382), D398 (= D385)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:459/509 of 3f4jA
- binding glycine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F247 (= F226), T248 (≠ S227), S250 (= S229)
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), G22 (= G27), N23 (= N28), T248 (≠ S227), N280 (≠ D259), A345 (= A321), G346 (≠ A322), T348 (= T324), S349 (= S325)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:459/509 of 3f3dA
- binding methionine: N17 (≠ S22), A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F247 (= F226), T248 (≠ S227), S250 (= S229), S349 (= S325), I353 (≠ L329)
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T248 (≠ S227), N280 (≠ D259), A345 (= A321), T348 (= T324), S349 (= S325)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:459/509 of 3f3cA
- binding sodium ion: G16 (= G21), A18 (= A23), V19 (= V24), V19 (= V24), G20 (= G25), N23 (= N28), T248 (≠ S227), N280 (≠ D259), A345 (= A321), T348 (= T324), S349 (= S325)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S22), A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F247 (= F226), T248 (≠ S227), S250 (= S229), F253 (≠ M232), S349 (= S325), I353 (≠ L329)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
31% identity, 97% coverage: 6:448/456 of query aligns to 1:459/498 of 3gwvA
- binding leucine: A18 (= A23), G20 (= G25), G22 (= G27), Y104 (= Y105), F247 (= F226), T248 (≠ S227), S250 (= S229), F253 (≠ M232)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L26), R26 (= R31), A313 (≠ G284), F314 (≠ P285), L394 (≠ F381), D395 (= D382), D398 (= D385)
Query Sequence
>353168 FitnessBrowser__Btheta:353168
MTKIDRANFGSKLGVILASAGSAVGLGNIWRFPYETGNHGGAAFILIYLGCVFLLGLPIL
IAEFLIGRRSRANTAGAYQKLAPGTHWRWVGRMGVLAAFLILSYYSVVAGWTLEYVYEAL
TNGFTGKTPTEFISSFQQFSSSPWRPVLWLVLFLLVTHFIIVKGVEKGIEKSSKIMMPTL
FIIILILVICSVTLPGAGAGIEFLLKPDFSKVDGNVFLSAMGQAFFSLSLGMGCLCTYAS
YFSKETNLTKTAFSVGIIDTFVAVLAGFIIFPAAFSVGIQPDAGPSLIFITLPNVFQQAF
SGVPILAYIFSVMFYVLLAMAALTSTISLHEVVTAYLHEEFNFTRGKAARLVTGGCIFLG
ILCSLSLGVMKGFTIFGLGIFDLFDFVTAKIMLTLGGLCISIFTGWYLDKKIVWSEITND
GSLKVPVYKLIIFILRYIAPIAISLIFINELGLIKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory