SitesBLAST
Comparing 353281 FitnessBrowser__Btheta:353281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3eq6A Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in a ternary complex with products (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 4:533/533 of 3eq6A
- active site: T185 (= T203), T328 (= T346), E329 (= E347), N431 (≠ K449), R436 (= R454), K521 (= K539)
- binding adenosine monophosphate: G302 (= G320), E303 (= E321), S304 (≠ A322), E323 (= E341), S324 (≠ G342), Y325 (≠ F343), G326 (= G344), Q327 (= Q345), T328 (= T346), D410 (= D428), F422 (= F440), R425 (= R443), R436 (= R454)
- binding Butyryl Coenzyme A: W229 (= W247), F255 (= F273), I277 (≠ T295), V301 (≠ A319), S433 (= S451), G434 (= G452), Y435 (= Y453), P501 (= P519), Y502 (= Y520), Y504 (= Y522), R506 (= R524)
3b7wA Crystal structure of human acyl-coa synthetase medium-chain family member 2a, with l64p mutation (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 8:537/537 of 3b7wA
2wd9A Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with ibuprofen (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 4:533/533 of 2wd9A
- active site: T185 (= T203), T328 (= T346), E329 (= E347), N431 (≠ K449), R436 (= R454), K521 (= K539)
- binding ibuprofen: I230 (≠ G248), L231 (≠ K249), G326 (= G344), Q327 (= Q345), T328 (= T346), R436 (= R454)
2vzeA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with amp (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 4:533/533 of 2vzeA
- active site: T185 (= T203), T328 (= T346), E329 (= E347), N431 (≠ K449), R436 (= R454), K521 (= K539)
- binding adenosine monophosphate: W229 (= W247), G302 (= G320), E303 (= E321), S304 (≠ A322), E323 (= E341), Y325 (≠ F343), G326 (= G344), Q327 (= Q345), T328 (= T346), D410 (= D428), F422 (= F440), R425 (= R443), R436 (= R454)
3c5eA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with atp (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 7:536/536 of 3c5eA
- active site: T188 (= T203), T331 (= T346), E332 (= E347), N434 (≠ K449), R439 (= R454), K524 (= K539)
- binding adenosine-5'-triphosphate: T188 (= T203), S189 (= S204), G190 (= G205), T191 (= T206), S192 (≠ T207), G305 (= G320), E306 (= E321), S307 (≠ A322), G329 (= G344), Q330 (= Q345), T331 (= T346), D413 (= D428), F425 (= F440), R428 (= R443), K524 (= K539)
- binding magnesium ion: M450 (= M465), H452 (= H467), V455 (= V470)
Q08AH3 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; Acyl-CoA synthetase medium-chain family member 2A; Benzoate--CoA ligase; Butyrate--CoA ligase 2A; Butyryl-coenzyme A synthetase 2A; Middle-chain acyl-CoA synthetase 2A; EC 6.2.1.2; EC 6.2.1.25 from Homo sapiens (Human) (see 4 papers)
38% identity, 96% coverage: 25:551/551 of query aligns to 40:569/577 of Q08AH3
- Q139 (≠ L118) binding
- 221:229 (vs. 203:211, 78% identical) binding
- ESYGQT 359:364 (≠ EGFGQT 341:346) binding
- T364 (= T346) binding
- D446 (= D428) binding
- R461 (= R443) binding
- SGY 469:471 (= SGY 451:453) binding
- R472 (= R454) binding
- R501 (= R483) binding
- S513 (≠ K495) to L: in dbSNP:rs1133607
- K532 (= K514) binding
- YPR 540:542 (= YPR 522:524) binding
- K557 (= K539) binding
3dayA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in complex with amp-cpp (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 8:535/535 of 3dayA
- active site: T189 (= T203), T332 (= T346), E333 (= E347), N435 (≠ K449), R440 (= R454), K523 (= K539)
- binding diphosphomethylphosphonic acid adenosyl ester: T189 (= T203), S190 (= S204), G191 (= G205), T192 (= T206), S193 (≠ T207), K197 (= K211), G306 (= G320), E307 (= E321), S308 (≠ A322), Y329 (≠ F343), G330 (= G344), Q331 (= Q345), T332 (= T346), D414 (= D428), F426 (= F440), R429 (= R443), K523 (= K539)
- binding magnesium ion: M451 (= M465), H453 (= H467), V456 (= V470)
3gpcA Crystal structure of human acyl-coa synthetase medium-chain family member 2a (l64p mutation) in a complex with coa (see paper)
38% identity, 96% coverage: 25:551/551 of query aligns to 5:532/532 of 3gpcA
- active site: T186 (= T203), T327 (= T346), E328 (= E347), N430 (≠ K449), R435 (= R454), K520 (= K539)
- binding coenzyme a: G301 (= G320), E302 (= E321), S303 (≠ A322), E322 (= E341), Y324 (≠ F343), G325 (= G344), Q326 (= Q345), T327 (= T346), D409 (= D428), F421 (= F440), R424 (= R443), T516 (= T535), K520 (= K539), Q522 (≠ R541)
- binding magnesium ion: H448 (= H467), V451 (= V470)
8biqB Crystal structure of acyl-coa synthetase from metallosphaera sedula in complex with acetyl-amp
40% identity, 94% coverage: 29:545/551 of query aligns to 35:541/561 of 8biqB
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: G319 (= G320), E320 (= E321), P321 (≠ A322), D340 (≠ E341), F341 (≠ G342), Y342 (≠ F343), G343 (= G344), Q344 (= Q345), T345 (= T346), D426 (= D428), F438 (= F440), K447 (= K449), R452 (= R454)
8biqA Crystal structure of acyl-coa synthetase from metallosphaera sedula in complex with acetyl-amp
40% identity, 94% coverage: 29:545/551 of query aligns to 36:542/562 of 8biqA
8bitA Crystal structure of acyl-coa synthetase from metallosphaera sedula in complex with coenzyme a and acetyl-amp
40% identity, 94% coverage: 29:545/551 of query aligns to 37:543/562 of 8bitA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W252 (= W252), G321 (= G320), E322 (= E321), P323 (≠ A322), D342 (≠ E341), F343 (≠ G342), Y344 (≠ F343), Q346 (= Q345), T347 (= T346), D428 (= D428), F440 (= F440), K449 (= K449), R454 (= R454)
- binding coenzyme a: N128 (≠ L118), W247 (= W247), K249 (= K249), K273 (= K272), L274 (≠ F273), Q300 (≠ F299), D452 (≠ G452), Y453 (= Y453), R483 (= R483), P517 (= P519)
4wv3B Crystal structure of the anthranilate coa ligase auaeii in complex with anthranoyl-amp (see paper)
31% identity, 93% coverage: 33:547/551 of query aligns to 10:510/518 of 4wv3B
- active site: S175 (≠ T203), T320 (= T346), E321 (= E347), K418 (= K449), W423 (≠ R454), K502 (= K539)
- binding 5'-O-[(S)-[(2-aminobenzoyl)oxy](hydroxy)phosphoryl]adenosine: F220 (≠ W247), T221 (≠ G248), F222 (≠ K249), A293 (= A319), S294 (≠ G320), E295 (= E321), A296 (= A322), G316 (= G342), I317 (≠ F343), G318 (= G344), C319 (≠ Q345), T320 (= T346), D397 (= D428), H409 (≠ F440), R412 (= R443), K502 (= K539)
7l4gB Crystal structure of acetyl-coa synthetase in complex with acetyl adenylate from cryptococcus neoformans h99
31% identity, 94% coverage: 28:547/551 of query aligns to 92:639/668 of 7l4gB
- active site: T280 (= T203), T432 (= T346), E433 (= E347), N539 (≠ K449), R544 (= R454), K631 (= K539)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W247), G403 (= G320), E404 (= E321), P405 (≠ A322), T428 (≠ G342), Y429 (≠ F343), W430 (≠ G344), M431 (≠ Q345), T432 (= T346), D518 (= D428), I530 (≠ F440), R533 (= R443)
5u29A Crystal structure of cryptococcus neoformans h99 acetyl-coa synthetase in complex with ac-ams
31% identity, 94% coverage: 28:547/551 of query aligns to 92:639/668 of 5u29A
- active site: T280 (= T203), T432 (= T346), E433 (= E347), N539 (≠ K449), R544 (= R454), K631 (= K539)
- binding 5'-O-(acetylsulfamoyl)adenosine: W325 (= W247), G403 (= G320), E404 (= E321), P405 (≠ A322), T428 (≠ G342), Y429 (≠ F343), W430 (≠ G344), M431 (≠ Q345), T432 (= T346), D518 (= D428), I530 (≠ F440), R533 (= R443)
5k8fA Crystal structure of acetyl-coa synthetase in complex with atp and acetyl-amp from cryptococcus neoformans h99
31% identity, 94% coverage: 28:547/551 of query aligns to 92:639/656 of 5k8fA
- active site: T280 (= T203), T432 (= T346), E433 (= E347), N539 (≠ K449), R544 (= R454), K631 (= K539)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W247), I326 (≠ G248), G403 (= G320), E404 (= E321), P405 (≠ A322), T428 (≠ G342), Y429 (≠ F343), W430 (≠ G344), M431 (≠ Q345), T432 (= T346), D518 (= D428), I530 (≠ F440), R533 (= R443), K631 (= K539)
- binding adenosine-5'-triphosphate: T280 (= T203), S281 (= S204), G282 (= G205), S283 (≠ T206), T284 (= T207), K288 (= K211), G403 (= G320), E404 (= E321), P405 (≠ A322), T428 (≠ G342), Y429 (≠ F343), M431 (≠ Q345), T432 (= T346), D518 (= D428), I530 (≠ F440), R533 (= R443), K631 (= K539)
8w0cA Acetyl-coenzyme A synthetase 2
30% identity, 94% coverage: 29:547/551 of query aligns to 88:633/667 of 8w0cA
- binding 5'-O-[(S)-(cyclopentyloxy)(hydroxy)phosphoryl]adenosine: G399 (= G320), E400 (= E321), P401 (≠ A322), T424 (≠ G342), Y425 (≠ F343), W426 (≠ G344), Q427 (= Q345), T428 (= T346), D514 (= D428), R529 (= R443), R540 (= R454)
8w0bA Acetyl-coenzyme A synthetase 2
30% identity, 94% coverage: 29:547/551 of query aligns to 88:633/667 of 8w0bA
- binding 5'-O-[(R)-(cyclopropyloxy)(hydroxy)phosphoryl]adenosine: V398 (≠ A319), G399 (= G320), E400 (= E321), P401 (≠ A322), T424 (≠ G342), Y425 (≠ F343), W426 (≠ G344), Q427 (= Q345), T428 (= T346), D514 (= D428), I526 (≠ F440), R529 (= R443), R540 (= R454)
8w0dA Acetyl-coenzyme A synthetase 2
30% identity, 94% coverage: 29:547/551 of query aligns to 87:632/666 of 8w0dA
- binding 5'-O-{(R)-hydroxy[(propan-2-yl)oxy]phosphoryl}adenosine: G398 (= G320), E399 (= E321), P400 (≠ A322), T423 (≠ G342), Y424 (≠ F343), W425 (≠ G344), Q426 (= Q345), T427 (= T346), D513 (= D428), I525 (≠ F440), R528 (= R443), R539 (= R454)
8v4rA Crystal structure of acetyl-coa synthetase 2 in complex with amp and coa from candida albicans
30% identity, 94% coverage: 29:547/551 of query aligns to 87:632/666 of 8v4rA
- binding adenosine monophosphate: G398 (= G320), E399 (= E321), P400 (≠ A322), T423 (≠ G342), Y424 (≠ F343), Q426 (= Q345), T427 (= T346), D513 (= D428), I525 (≠ F440), R528 (= R443), R539 (= R454)
- binding coenzyme a: F175 (≠ T116), R203 (vs. gap), R206 (vs. gap), G316 (≠ A243), H538 (≠ Y453), R599 (≠ K514), F605 (≠ Y520)
5jrhA Crystal structure of salmonella enterica acetyl-coa synthetase (acs) in complex with camp and coenzyme a (see paper)
30% identity, 98% coverage: 6:547/551 of query aligns to 51:613/640 of 5jrhA
- active site: T260 (= T203), T412 (= T346), E413 (= E347), N517 (≠ K449), R522 (= R454), K605 (= K539)
- binding (r,r)-2,3-butanediol: W93 (= W51), E140 (= E97), G169 (≠ Y126), K266 (≠ E209), P267 (= P210)
- binding adenosine-3',5'-cyclic-monophosphate: G383 (= G320), E384 (= E321), P385 (≠ A322), T408 (≠ G342), W409 (≠ F343), W410 (≠ G344), Q411 (= Q345), T412 (= T346), D496 (= D428), I508 (≠ F440), N517 (≠ K449), R522 (= R454)
- binding coenzyme a: F159 (≠ T116), G160 (≠ H117), G161 (≠ L118), R187 (vs. gap), S519 (= S451), R580 (≠ K514), P585 (= P519)
- binding magnesium ion: V533 (≠ M465), H535 (= H467), I538 (≠ V470)
Query Sequence
>353281 FitnessBrowser__Btheta:353281
MVERFLAQTSFASQEDFIKNLKINVPENFNFGYDVVDAWAAEQPDKNALLWTNDQGESRQ
FSFADMKRYTDMTASYFQSLGIGRGDMVMLILKRRYEFWYSTIALHKLGATVIPATHLLT
KKDIIYRCNAADIKMIVAAGEGIILQHIKDALPECPSVEKLVSVGPEVPEGFEDFHQGID
NAAPFIRPRHANTNDDISLMYFTSGTTGEPKMVAHDFTYPLGHIVTGSFWHNLDENSLHL
TIADTGWGKAVWGKLYGQWIAGANIFVYDHEKFTPAAILEKIQEYQVTSLCAPPTIFRFL
IHEDLTKYDLSSLRYCTIAGEALNPAVFETFKKLTGIKLMEGFGQTETTLTVATMPWMEP
KPGSMGLPNPQYDVDLIDSEGRSVEAGEQGQIVIRTSKGKPLGLFKEYYRDAERTHEAWH
DGIYYTGDVAWKDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVIECAITGVPD
EIRGQVVKATIVLSKDYKARAGEELIKELQNHVKKVTAPYKYPRVIEFVDELPKTISGKI
RRVEIRENDEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory